| 5306 different keyphrases | Search | Percent |
|---|
| novel thermoelectric materials | 213 | 2.7 % |
| browsebydegree/thesistype-caltechthesis | 64 | 0.8 % |
| null | 62 | 0.8 % |
| browsebydegree-caltechthesis | 32 | 0.4 % |
| content | 22 | 0.2 % |
| browsebyauthor-caltechthesis | 22 | 0.2 % |
| browsebyeprintid-caltechthesis | 22 | 0.2 % |
| browsebycommitteemember-caltechthesis | 21 | 0.2 % |
| browsebyadvisor-caltechthesis | 21 | 0.2 % |
| caltech thesis | 16 | 0.2 % |
| stratigraphy iran pdf | 13 | 0.1 % |
| sp1 gda | 13 | 0.1 % |
| aurora borealis | 11 | 0.1 % |
| themicrowavethermalthrusteranditsapplicationtothelaunchproblem-caltechthesis | 11 | 0.1 % |
| xx469c/m | 9 | 0.1 % |
| itemswhereoptionis computationandneuralsystems andyearis2007-caltechthesis | 8 | 0.1 % |
| http //thesis.library.caltech.edu/8648/1/gomez_marcellam_thesis_2015.pdf | 8 | 0.1 % |
| best acknowledgement for thesis | 8 | 0.1 % |
| kdipc | 8 | 0.1 % |
| interactionsofvisualattentionandobjectrecognition computationalmodeling algorithms andpsychophysics-caltechthesis | 7 | 0 % |
| i.applicationofnormalmodetheorytoseismicsourceandstructureproblems.ii.seismicinvestigationsofuppermantlelateralheterogeneity.-caltechthesis | 7 | 0 % |
| photochemicalstudiesofjupiterandtitan-caltechthesis | 6 | 0 % |
| history and manzana colony and antelope valley ca | 6 | 0 % |
| models of bottom-up and top-down visual attention | 6 | 0 % |
| interactionofhydrogenwithnovelcarbonmaterials-caltechthesis | 6 | 0 % |
| run-upandnonlinearpropagationofoceanicinternalwavesandtheirinteractions-caltechthesis | 6 | 0 % |
| knudsen diffusion | 6 | 0 % |
| superconducting ressonators multiplexing | 6 | 0 % |
| dr. william royea | 6 | 0 % |
| bqa | 6 | 0 % |
| vitreoscillahemoglobin genestructureandregulationfunctions andapplicationstoaerobicbioprocesses-caltechthesis | 6 | 0 % |
| www.155955.cam | 6 | 0 % |
| arc voltage measurement | 6 | 0 % |
| the | 6 | 0 % |
| circlepatterns memberlist | 6 | 0 % |
| chemical composition of mental flumes | 5 | 0 % |
| passivecontrolofflutterandforcedresponseinbladeddisksviamistuning-caltechthesis | 5 | 0 % |
| secrecy | 5 | 0 % |
| astudyofthepolarizationofwaterandmethanolbyvariousdiamagneticionsinanaproticsolvent-caltechthesis | 5 | 0 % |
| onquantuminteractingembeddedgeometricalobjectsofvariousdimensions-caltechthesis | 5 | 0 % |
| reliableintegrationofterascalesystemswithnanoscaledevices-caltechthesis | 5 | 0 % |
| supersonicfilmcoolingincludingtheeffectofshockwaveinteraction-caltechthesis | 5 | 0 % |
| pylith | 5 | 0 % |
| studyofthestall-spinphenomenausinganalysisandinteractive3-dgraphics-caltechthesis | 5 | 0 % |
| designingproteinseparationsbasedonmetal-affinityinteractions-caltechthesis | 5 | 0 % |
| impedance pump math model | 5 | 0 % |
| a probabilistic treatment of uncertainty in nonlinear dynamical systems | 5 | 0 % |
| experimentalstudyofheliumdiffusioninthewakeofacircularcylinderatm=5.8-caltechthesis | 5 | 0 % |
| itemswhereoptionis socialscience andyearis2004-caltechthesis | 5 | 0 % |
| http //resolver.caltech.edu/caltechthesis 08272014-031912941 | 5 | 0 % |
| interactionsofammoniawithplatinumandrutheniumsurfaces-caltechthesis | 5 | 0 % |
| implantable wireless intraocular pressure sensors | 5 | 0 % |
| publications | 5 | 0 % |
| elsinore fault zone san diego county ca | 5 | 0 % |
| author morgan author a.j.a. | 5 | 0 % |
| theinteractionofbreakingsolitarywaveswithanarmoredbed-caltechthesis | 5 | 0 % |
| themultistrandsimulator stochasticsimulationofthekineticsofmultipleinteractingdnastrands-caltechthesis | 5 | 0 % |
| anisotropiesandinteractionsinshearflowofmacromolecularsuspensions-caltechthesis | 5 | 0 % |
| astudyofalaterallyloadedthincircularcylindricalshell-caltechthesis | 5 | 0 % |
| the coefficient of thermal expansion of ethylen oxyde | 5 | 0 % |
| sample questionare for thesis | 4 | 0 % |
| computeraidedmasklayoutsynthesisforanisotrophicetchphotolithography-caltechthesis | 4 | 0 % |
| thekinetictheoryofthesolarwindanditsinteractionwiththemoon-caltechthesis | 4 | 0 % |
| a | 4 | 0 % |
| finiteelementsimulationandanalysisoflocalstressconcentrationinpolymerswithanonlinearviscoelasticconstitutivemodel-caltechthesis | 4 | 0 % |
| tectonichistoryoftheosbournspreadingcenteranddynamicsubsidenceofthecongobasin-caltechthesis | 4 | 0 % |
| microtoroid | 4 | 0 % |
| dedication thesis | 4 | 0 % |
| satellite theory | 4 | 0 % |
| themotionofadiscatangleofattackinarapidlyrotatingfluid-caltechthesis | 4 | 0 % |
| studiesofexcitoncondensationandtransportinquantumhallbilayers-caltechthesis | 4 | 0 % |
| sheet stiffner panel | 4 | 0 % |
| interactionsbetweentroposphericchemistryandaerosolsinaunifiedgcmsimulation-caltechthesis | 4 | 0 % |
| organic-functionalizedmolecularsieves ofms s anewclassofmaterials-caltechthesis | 4 | 0 % |
| www.231uo.cum | 4 | 0 % |
| latecretaceousgravitationalcollapseofthesouthernsierranevadabatholithandadjacentareasaboveunderplatedschists southerncalifornia-caltechthesis | 4 | 0 % |
| interactionsbetweenmoleculesandsuperconductors-caltechthesis | 4 | 0 % |
| ameasurementofthespin-dependentasymmetryinquasielasticscatteringofpolarizedelectronsfrompolarized^3he-caltechthesis | 4 | 0 % |
| parti structureofcentralandsouthernmexicofromvelocityandattenuationtomography;partii physicsofsmallrepeatingearthquakes-caltechthesis | 4 | 0 % |
| pointvortexmodelsformodondynamics-caltechthesis | 4 | 0 % |
| i.theuseofdeuteratedphospholipidstoelucidatelipid-lipidinteractionsinbilayervesicles.ii.theeffectofchainlengthonthesecondarystructureofoligoadenylates-caltechthesis | 4 | 0 % |
| unsplitnumericalschemesforhyperbolicsystemsofconservationlawswithsourceterms-caltechthesis | 4 | 0 % |
| circlepatterns mesh edgeiteratorclassreference | 4 | 0 % |
| atheoreticalstudyofreactionanddiffusioninmicrostructuredmaterials-caltechthesis | 4 | 0 % |
| thesis acknowledgement | 4 | 0 % |
| integrastatin | 4 | 0 % |
| intracellularinteractionsofpolioviruses interferenceandmultiplicityreactivation-caltechthesis | 4 | 0 % |
| hp52.ned | 4 | 0 % |
| an investigation of ion engine erosion by low energy sput-tering | 4 | 0 % |
| studies on hot gas hydrogen sulfide removal sorbents in fixedbedreactors at high temperatures | 4 | 0 % |
| thesis on ruthenium complex | 4 | 0 % |
| http //resolver.caltech.edu/caltechthesis 05062011-142849302 | 4 | 0 % |
| thegeologyoftheeastcoachellatunnelofthemetropolitanwaterdistrictofsoutherncalifornia-caltechthesis | 4 | 0 % |
| animac amultiprocessorarchitectureforreal-timecomputeranimation-caltechthesis | 4 | 0 % |
| reactors periodic catalyst re-oxidation odh industrial process | 4 | 0 % |
| discrete vorticity-preserving | 4 | 0 % |
| searchforsignaturesofextradimensionsinthediphotonmassspectrumwiththecmsdetector-caltechthesis | 4 | 0 % |
| vertical sand drain | 4 | 0 % |
| generalizedtranslationoperators-caltechthesis | 4 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-02 -urlexit | 4 | 0 % |
| robustbilateraltradeandanessayonawarenessasanequilibriumnotion-caltechthesis | 4 | 0 % |
| major applications of holography | 4 | 0 % |
| dualpolarizedandbalancedreceiversatmillimeterandsubmillimeterwavelengths-caltechthesis | 4 | 0 % |
| iterativedecodingandpseudo-codewords-caltechthesis | 4 | 0 % |
| analysisofmillimeterandmicrowaveintegratedcircuits-caltechthesis | 4 | 0 % |
| avg | 4 | 0 % |
| gahlmann dissertation | 4 | 0 % |
| parti.interactionofdnaandhistoneinnucleohistone;partii.dormancyassociatedwithrepressionofgeneticactivity-caltechthesis | 4 | 0 % |
| reaction mechanism of octahedralcopper ii and nickel ii complexes and the intermediates | 4 | 0 % |
| ni40cu5ti16.5zr28.5al10 | 4 | 0 % |
| steady motion of vortex | 4 | 0 % |
| solvent-resistant microfluidic devices | 4 | 0 % |
| i.developmentofacryogenicshocktube.ii.experimentalinvestigationoftheinteractionofashockwavewithliquidheliumiandii-caltechthesis | 4 | 0 % |
| informationprocessingintheinterauraltimedifferencepathwayofthebarnowl-caltechthesis | 4 | 0 % |
| graphicalmodelsanditerativedecoding-caltechthesis | 4 | 0 % |
| modelling analysis and design of switching converters | 4 | 0 % |
| bacterial commensalism | 4 | 0 % |
| synapticlearningrulesforlocalsynapticinteractions theoryandapplicationtodirectionselectivity-caltechthesis | 4 | 0 % |
| circlepatterns mesh vertexiteratorclassreference | 4 | 0 % |
| stratigraphyandcorrelationofthemarinejurassicdepositsofcentraloregon-caltechthesis | 4 | 0 % |
| crosstalkbetweensolublefactorsandcell-cellinteractions implicationsforcellcyclecontrolandtumordevelopment-caltechthesis | 4 | 0 % |
| pitch distribution | 4 | 0 % |
| concurrentdynamicsimulation multicomputeralgorithmsresearchappliedtoordinarydifferential-algebraicprocesssystemsinchemicalengineering-caltechthesis | 4 | 0 % |
| i.globalsimulationsofinteractionsbetweenaerosolsandfutureclimateandii.sensitivityofmultiangleimagingtotheopticalandmicrophysicalpropertiesofbiomassburningaerosols-caltechthesis | 4 | 0 % |
| type somehing | 4 | 0 % |
| encodingoffinancialsignalsinthehumanbrain-caltechthesis | 4 | 0 % |
| astudyofmolecularandphysicalprocessesincomets-caltechthesis | 4 | 0 % |
| catalystsforolefinmetathesis rutheniumalkylidenecomplexeswithphosphineandn-heterocycliccarbeneligands-caltechthesis | 4 | 0 % |
| microwaveinteractionwithboundedgyroelectricplasmas-caltechthesis | 4 | 0 % |
| shapechangingtransformations interactionswithplasticityandelectrochemicalprocesses-caltechthesis | 4 | 0 % |
| evolution of igm molecules | 4 | 0 % |
| atheoreticalstudyofpoliticalinstitutionsandeconomicpolicies-caltechthesis | 4 | 0 % |
| opticsatthenanoscale lightemissioninplasmonicnanocavities-caltechthesis | 4 | 0 % |
| anexperimentalstudyoftheinteractionofwaterwithgraniticmelt-caltechthesis | 4 | 0 % |
| flow past a circular cylinder with a permeable splitter plate | 4 | 0 % |
| experimentalinvestigationofrotor-statorinteractionindiffuserpumps-caltechthesis | 4 | 0 % |
| dissectingthegravitationallensb1608 656 implicationsforthehubbleconstant-caltechthesis | 4 | 0 % |
| preparation of oxalic acid | 4 | 0 % |
| theoryofthescatteringofelectromagneticwavesbyirregularinterfaces-caltechthesis | 4 | 0 % |
| assignment problem thesis | 4 | 0 % |
| homogeneous nucleation theory | 4 | 0 % |
| semiconductormagnetoelectronicsforspintronicsandsuspended2degformechanoelectronics-caltechthesis | 4 | 0 % |
| itemswhereoptionis environmentalscienceandengineering andyearis2002-caltechthesis | 4 | 0 % |
| quantitativecharacterizationof3ddeformationsofcellinteractionswithsoftbiomaterials-caltechthesis | 4 | 0 % |
| statisticsforthesis.library.caltech.edu 2007-09 -browserdetail | 3 | 0 % |
| invitroselectionofmrna-displaylibrariescontainingunnaturalaminoacids-caltechthesis | 3 | 0 % |
| gasemissivitiesandradiativetransferstudies-caltechthesis | 3 | 0 % |
| investigation of drag coefficient of a sphere using a viscous drag apparatus | 3 | 0 % |
| thermodynamicmodelingoforganicaerosol-caltechthesis | 3 | 0 % |
| itemswhereoptionis appliedphysics andyearis1983-caltechthesis | 3 | 0 % |
| transistorswitchinganalysis-caltechthesis | 3 | 0 % |
| best acknowledgements | 3 | 0 % |
| itemswhereoptionis appliedmechanics andyearis1966-caltechthesis | 3 | 0 % |
| ahmed elbanna | 3 | 0 % |
| cavity flow control | 3 | 0 % |
| studiesofthemetalioncomplexesofpurinesandpyrimidinesbyelectrophoresisandothermethods-caltechthesis | 3 | 0 % |
| itemswhereoptionis biology andyearis1951-caltechthesis | 3 | 0 % |
| electronicstructureandphotochemicalreactivityofbinuclearmetalcomplexes-caltechthesis | 3 | 0 % |
| stress at fillet radius | 3 | 0 % |
| itemswhereoptionis appliedmechanics andyearis1995-caltechthesis | 3 | 0 % |
| Ìì½ò°üƤ | 3 | 0 % |
| iridium 192 decay process | 3 | 0 % |
| astudyofhorizontalcell-photoreceptorinteractioninthefrogretinausingarandomlymodulatedstimulus-caltechthesis | 3 | 0 % |
| developmentofastructurepredictionmethodforg-proteincoupledreceptors-caltechthesis | 3 | 0 % |
| enantioselectiveorganocatalyticfriedel-craftsalkylationsofheterocyclesandelectron-richbenzenes-caltechthesis | 3 | 0 % |
| mckittrick tar seep | 3 | 0 % |
| theinfluenceofrandommediaonthepropagationanddepolarizationofelectromagneticwaves-caltechthesis | 3 | 0 % |
| verdel c 2009 . cenozoic geology of iran an integrated study of extensional tectonics and related volcanism. phd california institute of technology | 3 | 0 % |
| viscousflowandcrystallizationofbulkmetallicglassformingliquids-caltechthesis | 3 | 0 % |
| formationofcranialsensoryganglia roleofneuralcrestcplacodeinteractions slitcrobo andcadherins-caltechthesis | 3 | 0 % |
| holographicinformationsystems-caltechthesis | 3 | 0 % |
| arabidopsis superman | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-07 -allhosts | 3 | 0 % |
| effectsofsurfacemodificationoncharge-carrierdynamicsatsemiconductorinterfaces-caltechthesis | 3 | 0 % |
| micromechanicaltuningelementsforsubmillimeterwaveintegratedcircuits-caltechthesis | 3 | 0 % |
| nadia lapusta | 3 | 0 % |
| linguistic competence | 3 | 0 % |
| ultra-high-q planar microcavities andapplications | 3 | 0 % |
| perturbation effects in cavitation bubble dynamics | 3 | 0 % |
| solid phase dna synthesis by dr khurana | 3 | 0 % |
| dynamicsofspinningcompactbinariesingeneralrelativity-caltechthesis | 3 | 0 % |
| thefirstcaltech-jodrellbankvlbisurvey-caltechthesis | 3 | 0 % |
| distributed active transformer i.aoki | 3 | 0 % |
| stress driven diffusion | 3 | 0 % |
| pbse thermoelectric | 3 | 0 % |
| constitutivemodelsforpolymersandsoftbiologicaltissues-caltechthesis | 3 | 0 % |
| mouse subcutaneous injection toxic | 3 | 0 % |
| premixedstagnationflamedataandboundaryconditions-caltechthesis | 3 | 0 % |
| array-basedvaporsensingusingconductivecarbonblack-polymercompositethinfilmdetectors-caltechthesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-12 -refererpages | 3 | 0 % |
| i.synthesisofmethylenecyclobutanefrompentaerythritylchloride.ii.theattemptedsynthesisofcyclobutane.iii.reinvestigationofthesynthesisofspiroheptanedicarboxylicacid-caltechthesis | 3 | 0 % |
| movemes | 3 | 0 % |
| thermodynamic properties of phosphorus minerals[pdf] | 3 | 0 % |
| asearchforneutrinosfromgravitationalcollapsewiththemacroexperiment-caltechthesis | 3 | 0 % |
| itemswhereoptionis geochemistry andyearis1971-caltechthesis | 3 | 0 % |
| finitedeflectionsandbucklingofslightlycurvedbeamsandshallowsphericalshellsunderlateralloads-caltechthesis | 3 | 0 % |
| manipulatingfluids advancesinmicro-fluidics opto-fluidicsandfluidicself-assembly-caltechthesis | 3 | 0 % |
| detonationinteractionwithsharpanddiffuseinterfaces-caltechthesis | 3 | 0 % |
| trace elements in pyrite pyrrhotite and chalcopyrite of different ores | 3 | 0 % |
| astudyoftheeffectsofdislocationdensityandcrystalorientationonthekineticsofthecatalyzedoxidationofethyleneoverasinglecrystalofsilver-caltechthesis | 3 | 0 % |
| thecool-watertimmspointpleistocenehorizonatsanpedro california-caltechthesis | 3 | 0 % |
| theabundanceandbehaviorofvirusesinancientseawaterandmoderniron-richenvironments-caltechthesis | 3 | 0 % |
| gim19340001 | 3 | 0 % |
| analysisanddesignofprotographbasedldpccodesandensembles-caltechthesis | 3 | 0 % |
| interferometricmeasurementofbrightnessdistributionsindiscreteradiosources-caltechthesis | 3 | 0 % |
| ultrafast electron diffraction | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-08 -errors404 | 3 | 0 % |
| magnetostratigraphicinvestigationsofthelowerpaleozoicsystemboundaries andassociatedpaleogeographicimplications-caltechthesis | 3 | 0 % |
| hightimeresolutionobservationsofradiopulsars thefirstdetectionofcoherentemission-caltechthesis | 3 | 0 % |
| theinfraredbehaviourofquantumchromodynamics-caltechthesis | 3 | 0 % |
| mgzn2 | 3 | 0 % |
| optimalandcooperativecontrolofvehicleformations-caltechthesis | 3 | 0 % |
| reconfigurable robotic systems | 3 | 0 % |
| molecularcharacterizationofthedbf4/drf1-dependentkinase ddk andthednareplicationcheckpointmediatorclaspininxenopuseggextracts-caltechthesis | 3 | 0 % |
| what is the difference between experimental technique and procedure | 3 | 0 % |
| shockwaveinteractioninhypervelocityflow-caltechthesis | 3 | 0 % |
| isolationandcharacterizationoffactorsthatinteractwitheukaryotictranscriptionalenhancers-caltechthesis | 3 | 0 % |
| interactionofweakshockwavesanddiscretegasinhomogeneities-caltechthesis | 3 | 0 % |
| itemswhereoptionis biology andyearis1993-caltechthesis | 3 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1993-caltechthesis | 3 | 0 % |
| circumstellarshellsoflate-typestars--astudyatmillimeterandinfraredwavelengths-caltechthesis | 3 | 0 % |
| quasi-lpv | 3 | 0 % |
| i.interactionsoffastandslowwavesinproblemswithtwotimescales.ii.anumericalexperimentonthestructureoftwo-dimensionalturbulentflow-caltechthesis | 3 | 0 % |
| i.astudyofthena^ 23 p ne^ 20 reactionforprotonbombardingenergiesfrom100to450kev.ii.ameasurementofthen^ 12 andb^ 12 half-lives-caltechthesis | 3 | 0 % |
| ultrasound compressed sensing aic | 3 | 0 % |
| experimentalinvestigationofthehydrodynamicforcesontheshroudofacentrifugalpumpimpeller-caltechthesis | 3 | 0 % |
| characterizationofreactionintermediatesandadsorbateinteractionsontheru 001 surface-caltechthesis | 3 | 0 % |
| san francisco earthquake dissertation | 3 | 0 % |
| single molecule spectroscopy | 3 | 0 % |
| 在标题 earthquake san andreas fault | 3 | 0 % |
| importance of polarization | 3 | 0 % |
| anexperimentalinvestigationofheattransferfromfinewirestostillairatlowdensity-caltechthesis | 3 | 0 % |
| adirectvelocitymeasurementapparatustodeterminethespecificelectroniccharge-caltechthesis | 3 | 0 % |
| inelasticinteractionsinthedynamicresponseofstructures-caltechthesis | 3 | 0 % |
| olive stohlman | 3 | 0 % |
| design of sequence-specific dna-binding molecules sci-hub | 3 | 0 % |
| asymptoticl2inequalitiesofmarkofftype-caltechthesis | 3 | 0 % |
| multiplesteadystatesindistillation-caltechthesis | 3 | 0 % |
| learning and classification system | 3 | 0 % |
| designanddeploymentofbicep anovelsmall-aperturecmbpolarimetertotestinflationarycosmology-caltechthesis | 3 | 0 % |
| daiqi linghu | 3 | 0 % |
| independent-particlepotential-energysurfacesforchemicalreactions-caltechthesis | 3 | 0 % |
| studiesinpanelflutterathighermachnumbers.i.flatandslightlycurvedpanelsatmachnumber2.81.ii.cylindricalshellswithboundarylayer-caltechthesis | 3 | 0 % |
| ccengel | 3 | 0 % |
| variationalarbitrarylagrangian-eulerianmethod-caltechthesis | 3 | 0 % |
| bloodfloweffectsonheartdevelopmentandaminimallyinvasivetechniqueforinvivoflowalterations-caltechthesis | 3 | 0 % |
| crossmodalinteractioninhumans-caltechthesis | 3 | 0 % |
| elastostaticinteractionofcracksintheinfiniteplane-caltechthesis | 3 | 0 % |
| cavityoptomechanicsinphotonicandphononiccrystals engineeringtheinteractionoflightandsoundatthenanoscale-caltechthesis | 3 | 0 % |
| 在标题 seismic san andreas fault | 3 | 0 % |
| optimizingend-to-endsystemperformanceformillimeterandsubmillimeterspectroscopyofprotostars widebandheterodynereceiversandsideband-deconvolutiontechniquesforrapidmolecular-linesurveys-caltechthesis | 3 | 0 % |
| directed evolution cellobiohydrolases | 3 | 0 % |
| developinghigh-affinityproteincaptureagentsandnanotechnology-basedplatformsforinvitrodiagnostics-caltechthesis | 3 | 0 % |
| physical adsorption | 3 | 0 % |
| interplaybetweenlong-rangeandshort-rangeinteractionsinpolymerself-assemblyandcelladhesion-caltechthesis | 3 | 0 % |
| broadbandsubmillimeterinstrumentationforthedetectionofdistantgalaxies-caltechthesis | 3 | 0 % |
| charactersusefulindeterminingthepositionofindividualteethinthepermanentcheck-toothseriesofmerychippinehorses-caltechthesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-04 -urldetail | 3 | 0 % |
| hypothesis for radioactivity | 3 | 0 % |
| geneticcontroloft-cellproliferationwithsyntheticrnaregulatorysystems-caltechthesis | 3 | 0 % |
| very large scale analog | 3 | 0 % |
| biogeochemicalimplicationsofchanginggroundwaterandsurfacewaterhydrologyatlakepowell utahandarizona andthemercedriver california usa-caltechthesis | 3 | 0 % |
| dennis r. kasper | 3 | 0 % |
| efficientautomaticengineeringdesignsynthesisviaevolutionaryexploration-caltechthesis | 3 | 0 % |
| itemswhereoptionis computerscience andyearis2009-caltechthesis | 3 | 0 % |
| optimalorthonormalsubbandcodingandlatticequantizationwithvectordithering-caltechthesis | 3 | 0 % |
| theinteractionofflowdiscontinuitieswithsmalldisturbancesinacompressiblefluid-caltechthesis | 3 | 0 % |
| theoriginsofinorganicacidityinfogs-caltechthesis | 3 | 0 % |
| applicationofsteadyandunsteadydetonationwavestopropulsion-caltechthesis | 3 | 0 % |
| non-vacuum type d metric | 3 | 0 % |
| upscalingfortwo-phaseflowsinporousmedia-caltechthesis | 3 | 0 % |
| aclassofthreedimensionaloptimumwingsinhypersonicflow-caltechthesis | 3 | 0 % |
| zhang kechun | 3 | 0 % |
| caltech combustion chambers | 3 | 0 % |
| double wedge airfoil | 3 | 0 % |
| itemswhereoptionis environmentalscienceandengineering andyearis2003-caltechthesis | 3 | 0 % |
| interactionlawforacollisionbetweentwosolidparticlesinaviscousliquid-caltechthesis | 3 | 0 % |
| theimpactofasynchronyoncomputerarchitecture-caltechthesis | 3 | 0 % |
| quantum many body | 3 | 0 % |
| sample questionare use in thesis | 3 | 0 % |
| impedance pump simulation | 3 | 0 % |
| i.anx-raydiffractionstudyofthecrystalstructureofcyclopropanecarbohydrazide.ii.atheoryofisotropichyperfineinteractioninpi-electronradicals-caltechthesis | 3 | 0 % |
| visualizingthemembraneconfinement traffickingandstructureofthegabatransporter gat1-caltechthesis | 3 | 0 % |
| thevibrationalspectrumofamon-atomicface-centeredcubiccrystallattice-caltechthesis | 3 | 0 % |
| conclusion of extra cellular matrix | 3 | 0 % |
| sample acknowledgement page pdf | 3 | 0 % |
| aninvestigationoftheinteractionofwaterandofsaturatedhydrocarbonswiththe 110 surfaceofiridium-caltechthesis | 3 | 0 % |
| thebehaviorofanunstableringchromosomeindrosophilamelanogaster-caltechthesis | 3 | 0 % |
| ondelayandsecurityinnetworkcoding-caltechthesis | 3 | 0 % |
| model acknowledgement for phd thesis | 3 | 0 % |
| sliding_mode_control | 3 | 0 % |
| mordenite fluoride sda defect | 3 | 0 % |
| glenn dibble physics textbook | 3 | 0 % |
| numerical solution of two point boundary value problems | 3 | 0 % |
| hypersonicviscous-inviscidflowinteractionsincludingboundarylayerseparationonaflatplateatangleofattack-caltechthesis | 3 | 0 % |
| onthechemicalcompositionofinterstellarmolecularclouds amillimeterandsubmillimeterspectrallinesurveyofomc-1-caltechthesis | 3 | 0 % |
| earthquake geology of the san andreas fault dissertation | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2011-01 -keyphrases | 3 | 0 % |
| i.chemicalstudyofnecroticcornmutants.ii.metabolismofakinin.iii.thechemicalnatureofaninsectgallgrowthfactor-caltechthesis | 3 | 0 % |
| semi-dilutepolymersolutionsinstrongflows.parti birefringenceandflowmodificationinextensionalflows.partii chaoticmixingintime-periodicflows-caltechthesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2007-09 -unknownos | 3 | 0 % |
| themembranefusionactivitiesofnativeandreconstitutedmumpsandsendaiviruses-caltechthesis | 3 | 0 % |
| cavitation and bubble dynamics | 3 | 0 % |
| radiativetransferandopacitycalculations-caltechthesis | 3 | 0 % |
| quantumcriticalphenomenainsuperfluidsandsuperconductors-caltechthesis | 3 | 0 % |
| mars diffusion surface ice | 3 | 0 % |
| atomisticsimulationsofbariumtitanate-caltechthesis | 3 | 0 % |
| designandcontrolstudiesonthefluidcatalyticcrackingprocess-caltechthesis | 3 | 0 % |
| axelrovertethereddynamicsandmotionplanningonextremeplanetaryterrain-caltechthesis | 3 | 0 % |
| photoproductionofpositivepionsfromhydrogenatsmallanglesatenergies700to1025mev-caltechthesis | 3 | 0 % |
| thedevelopmentoflow-ordermodelsforthestudyoffluid-structureinteraction-caltechthesis | 3 | 0 % |
| dedication for thesis | 3 | 0 % |
| cobalt catalyzation hydrogen stephanie laga | 3 | 0 % |
| the sis california | 3 | 0 % |
| icp-ms thesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-01 -unknownbrowser | 3 | 0 % |
| sample educational questionare for thesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-03 -errors404 | 3 | 0 % |
| temperatureandvelocitydistributioninnon-uniformturbulentflow-caltechthesis | 3 | 0 % |
| performancecalculationsofrockettripropellantsystems-caltechthesis | 3 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis1994-caltechthesis | 3 | 0 % |
| the secondary flow in a cascade of airfoils in a non-uniform stream | 3 | 0 % |
| nonsphericalvaporbubblecollapse-caltechthesis | 3 | 0 % |
| particlemotionincolloidaldispersions applicationstomicrorheologyandnonequilibriumdepletioninteractions-caltechthesis | 3 | 0 % |
| orificecoefficientsforanasymmetricalflowintoaslot-caltechthesis | 3 | 0 % |
| i retrievalofatmosphericcarbondioxidefromhigh-resolutionspectra.ii interannualvariabilityofthestratosphericquasi-biennualoscillation-caltechthesis | 3 | 0 % |
| independenceresultsforindescribablecardinals-caltechthesis | 3 | 0 % |
| a comparative study of aerosol deposition in different lung models | 3 | 0 % |
| rangedependentsignalsandmaximumentropymethodsforunderwateracoustictomography-caltechthesis | 3 | 0 % |
| i.ontheapplicationofalasertohighspeedphotography.ii.torsionalmagnetoelasticwavesinacircularcylinder-caltechthesis | 3 | 0 % |
| itemswhereoptionis civilengineering andyearis1963-caltechthesis | 3 | 0 % |
| i.irradiationexperimentswithneurosporacrassa.ii.anelectrophoreticcomparisonofthesolubleproteinsofnormalandvirus-infectedescherichiacoli-caltechthesis | 3 | 0 % |
| high-orderintegralequationmethodsfordiffractionproblemsinvolvingscreensandapertures-caltechthesis | 3 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1982-caltechthesis | 3 | 0 % |
| excitonsincrystallinebenzene-caltechthesis | 3 | 0 % |
| aninvestigationofgroundaccelerationsproducedbymachines-caltechthesis | 3 | 0 % |
| theinteractionofroussarcomavirusandcellsinvitro-caltechthesis | 3 | 0 % |
| dislocations pdf | 3 | 0 % |
| higgsscalarsandthenonleptonicweakinteractions-caltechthesis | 3 | 0 % |
| structure placementandmodelling-caltechthesis | 3 | 0 % |
| itemswhereoptionis astronomy andyearis1970-caltechthesis | 3 | 0 % |
| wetmur 1967 | 3 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics -caltechthesis | 3 | 0 % |
| monolithicmillimeter-wavetwo-dimensionalhornimagingarrays-caltechthesis | 3 | 0 % |
| bibliography thesis | 3 | 0 % |
| interaction between tropospheric chemistry and aerosols in a unified general circulation model | 3 | 0 % |
| thecharacterizationofbestnonlineartchebycheffapproximations-caltechthesis | 3 | 0 % |
| azotobacter | 3 | 0 % |
| investigationofturbulenceincirculartubesbymeansofahot-wireanemometer-caltechthesis | 3 | 0 % |
| chia-chieh chu | 3 | 0 % |
| glaucoma tube diameter length ligature | 3 | 0 % |
| protein-dnainteractions molecularmodelingandenergetics-caltechthesis | 3 | 0 % |
| silicon-based terahertz circuits and systems | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-06 -unknownbrowser | 3 | 0 % |
| itemswhereoptionis electricalengineering andyearis1962-caltechthesis | 3 | 0 % |
| discussion flat plate boundary layer experiment | 3 | 0 % |
| trigonometricexpansionsofdoublyperiodicfunctionsofthesecondkindinanynumberofvariables-caltechthesis | 3 | 0 % |
| features of robot map localization | 2 | 0 % |
| itemswhereoptionis physics andyearis1980-caltechthesis | 2 | 0 % |
| cal tech doctoral dissertation | 2 | 0 % |
| flowstructureinamodelofaircrafttrailingvortices-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-02 -main | 2 | 0 % |
| aninvertebrateassemblagefromthe modelo formationofreyniercanyon losangeles california.geologyandoriginoftalcdepositsofeasterncalifornia-caltechthesis | 2 | 0 % |
| conicsectoranalysisfordigitalcontrolsystemswithstructureduncertainty-caltechthesis | 2 | 0 % |
| thesis acknowledgement pdf | 2 | 0 % |
| perturbationeffectsincavitationbubbledynamics-caltechthesis | 2 | 0 % |
| quantumphasetransitionsindisorderedbosesystems-caltechthesis | 2 | 0 % |
| itemswhereoptionis controlanddynamicalsystems andyearis2011-caltechthesis | 2 | 0 % |
| unique | 2 | 0 % |
| theintrusivehistoryofthelittlechiefgraniteporpyhrystock centralpanamintrange california i.structuralrelationships.ii.petrogenesis basedonelectronmicroprobeanalysesofthefeldspars-caltechthesis | 2 | 0 % |
| andrew p. ingersoll yang da | 2 | 0 % |
| 188.165.240.46 | 2 | 0 % |
| germanium transister low noise | 2 | 0 % |
| speciesproducedinfiresburningintwo-layeredandhomogenousvitiatedenvironments-caltechthesis | 2 | 0 % |
| shortrangealphaparticlesfromthebombardmentoffluorinewithprotons-caltechthesis | 2 | 0 % |
| ananalyticalandcomputationalinvestigationofshock-inducedvorticalflowswithapplicationstosupersoniccombustion-caltechthesis | 2 | 0 % |
| importances of polarization | 2 | 0 % |
| hy ot be o rud | 2 | 0 % |
| dynamic chirp | 2 | 0 % |
| itemswhereoptionis electricalengineering andyearis1960-caltechthesis | 2 | 0 % |
| mappingthecytochromecfoldinglandscape-caltechthesis | 2 | 0 % |
| onthedopplereffectinamedium-caltechthesis | 2 | 0 % |
| affinity aconcurrentprogrammingsystemformulticomputers-caltechthesis | 2 | 0 % |
| disordered topological insulators | 2 | 0 % |
| longwavelengthingaasp/inplasersandoptoelectronicintegration-caltechthesis | 2 | 0 % |
| kern canyon fault map | 2 | 0 % |
| itemswhereoptionis environmentalscienceandengineering andyearis2001-caltechthesis | 2 | 0 % |
| effect of prandtl no. on pressure drop in smooth tube | 2 | 0 % |
| earthquake hazard in myanmar program pdf | 2 | 0 % |
| copper boride | 2 | 0 % |
| lao reaction scheme | 2 | 0 % |
| the symmetry of the fifth order basis is nonocality | 2 | 0 % |
| investigationofblockageeffectsfromflowaboutcircularcylindersinatwo-dimensionalwindtunnel-caltechthesis | 2 | 0 % |
| ethylene oligomerization | 2 | 0 % |
| casimir polder nano photonics | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-04 -unknownbrowser | 2 | 0 % |
| d-branesinanti-de-sitterspace-caltechthesis | 2 | 0 % |
| studyanddevelopmentofan electronicnose andcomparisonwithmammalianolfaction-caltechthesis | 2 | 0 % |
| weightenumeratorsandgraymapsoflinearcodesoverrings-caltechthesis | 2 | 0 % |
| experimentsonentrainment mixingandchemicalreactionsinturbulentjetsatlargeschmidtnumber-caltechthesis | 2 | 0 % |
| invarientsubspacesinhilbertandnormedspaces-caltechthesis | 2 | 0 % |
| computationaltopologyalgorithmsfordiscrete2-manifolds-caltechthesis | 2 | 0 % |
| mes0.50 | 2 | 0 % |
| table of contents phd | 2 | 0 % |
| directoutputfeedbackcontroloflargeflexiblespacecraft-caltechthesis | 2 | 0 % |
| photoproductionofneutralpionsfromcomplexnuclei anindirectmeasurementoftheСlifetime-caltechthesis | 2 | 0 % |
| wavefrontanalysisinthescatteringofaplanecompressionalpulsebyacylindricalelasticinclusion-caltechthesis | 2 | 0 % |
| elementsoffeed-forwardandfeedbackcontrolindrosophilabodysaccades-caltechthesis | 2 | 0 % |
| effectsofimpuritiesonthesupersaturationofnitrogeninahypersonicwindtunnel-caltechthesis | 2 | 0 % |
| convective mode granular material | 2 | 0 % |
| softx-raymicroimagingofwholewetcells-caltechthesis | 2 | 0 % |
| ultraviolet shows white dwarf stars and quasars | 2 | 0 % |
| socialinteractionsandgiving-caltechthesis | 2 | 0 % |
| whatisdeterministicchp andisslackelasticitythatuseful?-caltechthesis | 2 | 0 % |
| itemswhereoptionis biochemistryandmolecularbiophysics andyearis2011-caltechthesis | 2 | 0 % |
| isotopeeffectsinchemicalprocessesofatmosphericinterest-caltechthesis | 2 | 0 % |
| brillouin function pdf | 2 | 0 % |
| propellercharacteristicsandslipstreameffectsonahighwingmonoplanefromwindtunneltests-caltechthesis | 2 | 0 % |
| oxazole | 2 | 0 % |
| thevibrationalspectrumandstructureoforganiccrystals urea thiourea glycine-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-05 -browserdetail | 2 | 0 % |
| interactiveseismicimagingonamulticomputerandapplicationtothehosgrifault-caltechthesis | 2 | 0 % |
| drosophila visual | 2 | 0 % |
| kmno4 nano2 h20 | 2 | 0 % |
| http //thesis.library.caltech.edu/3828/ | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-01 -urlentry | 2 | 0 % |
| structuralconditionsandviolentstressreliefincoalminesofthesoutherncanadiancordillera-caltechthesis | 2 | 0 % |
| mechanicalpropertiesofbulkmetallicglassmatrixcomposites-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-07 -unknownbrowser | 2 | 0 % |
| aron varga fuel cell | 2 | 0 % |
| on the importance of polarization in radar scattering problems | 2 | 0 % |
| c. kluyveri activation of spores heat shock | 2 | 0 % |
| chamberstudiesofsecondaryorganicaerosolformation-caltechthesis | 2 | 0 % |
| to cool mechanical mode | 2 | 0 % |
| flow separation behind a rearward facing step | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-04 -unknownbrowser | 2 | 0 % |
| theultrafiltrationofsalt-polyelectrolytesolutions-caltechthesis | 2 | 0 % |
| itemswhereoptionis mathematics andyearis1967-caltechthesis | 2 | 0 % |
| imges of vertical communications | 2 | 0 % |
| sheet stiffener panel | 2 | 0 % |
| salton trough gravity | 2 | 0 % |
| e thesis on composits | 2 | 0 % |
| axially symmetric boundary layer | 2 | 0 % |
| technology of “bottom-up” and “top-down” | 2 | 0 % |
| applicationoffiniteelastictheorytothebehaviorofrubber-likematerials-caltechthesis | 2 | 0 % |
| superprotonicsolidacids structure properties andapplications-caltechthesis | 2 | 0 % |
| rheologicalbehaviorofcolloidalsuspensions theeffectsofhydrodynamicinteractions-caltechthesis | 2 | 0 % |
| applications of resonators | 2 | 0 % |
| regularizationoftheamendedpotentialaroundasymmetricconfiguration-caltechthesis | 2 | 0 % |
| articles icy bodies in solar system | 2 | 0 % |
| detonation diffraction through an abrupt area expansion | 2 | 0 % |
| caltech dye sensitized solar cell | 2 | 0 % |
| measurementofarcvoltageacrossopeningswitchcontacts-caltechthesis | 2 | 0 % |
| parti.photosensitizedisomerization.partii.photosensitizeddimerization-caltechthesis | 2 | 0 % |
| variationaltimeintegratorsincomputationalsolidmechanics-caltechthesis | 2 | 0 % |
| polymerintegratedoptics devicearchitecturesandfabricationmethods-caltechthesis | 2 | 0 % |
| protonolysis organometallic | 2 | 0 % |
| modelingstudiesrelatedtocarbondioxidephasechangeonmars-caltechthesis | 2 | 0 % |
| glia cell types pdf | 2 | 0 % |
| clusterexpansionappliedtoinelasticscatteringexperiments-caltechthesis | 2 | 0 % |
| itemswhereoptionis materialsscience andyearis2005-caltechthesis | 2 | 0 % |
| diffusion | 2 | 0 % |
| quantumtheoryofthespinningelectron-caltechthesis | 2 | 0 % |
| atomisticsimulationsofmaterials methodsforaccuratepotentialsandrealistictimescales-caltechthesis | 2 | 0 % |
| ageneralapproachtoperformanceanalysisandoptimizationofasynchronouscircuits-caltechthesis | 2 | 0 % |
| on vortex shedding from an airfoil | 2 | 0 % |
| theory of seismic accelerometer | 2 | 0 % |
| drosophila paulistorum ethanol tolerance | 2 | 0 % |
| topographyversusairmasses adiscussionofthephenomenaassociatedwiththepassageofairmassesovertheirregularitiesoftheearth ssurface-caltechthesis | 2 | 0 % |
| settling column analysis | 2 | 0 % |
| adaptivefeatureselectioninpatternrecognitionandultra-widebandradarsignalanalysis-caltechthesis | 2 | 0 % |
| r. busch j. schroers and w. h. wang mrs bull.32 620 2007 | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2011-01 -allhosts | 2 | 0 % |
| i.measurementofthelatentheatofvaporizationoflighterhydrocarbons--valuesfornormaloctane.ii.volumetricandphasebehaviorintheethane-propanesystem-caltechthesis | 2 | 0 % |
| astudyoffatiguenotchsensitivityof2014-tand7075-tatelevatedtemperatures-caltechthesis | 2 | 0 % |
| numerical solution of two point boundary value problems. | 2 | 0 % |
| force-detectednuclearmagneticresonanceindependentoffieldgradients-caltechthesis | 2 | 0 % |
| cal tech dissertation | 2 | 0 % |
| measurementsofpionchargeexchangeandotherthingsatfermilabenergies-caltechthesis | 2 | 0 % |
| i.complexesofmercury i withpolyphosphateanddicarboxylateanionsandmercury ii pyrophosphatecomplexes.ii.theinteractionofmercuricchloridewithdeoxyribonucleicacid-caltechthesis | 2 | 0 % |
| experimentalinvestigationofsecondsoundshockwavesinliquidheliumii-caltechthesis | 2 | 0 % |
| chemicalscaleinvestigationsofthegatingmechanismofionchannels-caltechthesis | 2 | 0 % |
| analytical models for heat efficiency of thermal methods of eor | 2 | 0 % |
| acknowledgement format for phd thesis | 2 | 0 % |
| properties of shock waves | 2 | 0 % |
| random walks in physical biology | 2 | 0 % |
| simple electron lense | 2 | 0 % |
| geologyofaportionofthelompocquadrangleofsantabarbaracounty california-caltechthesis | 2 | 0 % |
| i.measurementofdiamagneticanistrophyinsinglecrystals.ii.thecrystalstructureofmonomethylurea-caltechthesis | 2 | 0 % |
| anobject-orientedreal-timesimulationofmusicperformanceusinginteractivecontrol-caltechthesis | 2 | 0 % |
| wirelessnetworks newmodelsandresults-caltechthesis | 2 | 0 % |
| phototransduction principles t delbruck | 2 | 0 % |
| performance issues of wireless network | 2 | 0 % |
| high-precisioninfra-redstellarinterferometry-caltechthesis | 2 | 0 % |
| processingofmossyfiberactivityinthecerebellarcortex acombinationofcomputermodelingandelectrophysiologicalexperiments-caltechthesis | 2 | 0 % |
| axialflowfandesignbylatticetheory-caltechthesis | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis2011-caltechthesis | 2 | 0 % |
| amorphous metallic foam synthesis and mechanical properties | 2 | 0 % |
| hydrodynamicforcesinducedinfluidcontainersbyearthquakes-caltechthesis | 2 | 0 % |
| engineering extreme materials with defects and nonlinearity” chiara daraio | 2 | 0 % |
| tectonics and sedimentation along faults of the san andreas system | 2 | 0 % |
| theelasticscatteringofprotonsbyli7-caltechthesis | 2 | 0 % |
| acknowledgement of physics project | 2 | 0 % |
| anexperimentalinvestigationofhypersonicstagnationtemperatureprobes-caltechthesis | 2 | 0 % |
| flowfieldaroundafiniteconewithshock-caltechthesis | 2 | 0 % |
| ceramics silicon retina | 2 | 0 % |
| histidinemetabolisminliver-caltechthesis | 2 | 0 % |
| chemistryandelectronicsofthege 111 surface-caltechthesis | 2 | 0 % |
| lasercoolingofanoptomechanicalcrystalresonatortoitsquantumgroundstateofmotion-caltechthesis | 2 | 0 % |
| i.studyofmolecularorbitaldegeneracyinc5h5.ii.thecrystalandmolecularstructureofcyclopentadiene-caltechthesis | 2 | 0 % |
| albedoandspectralreflectivityofthegalileansatellitesofjupiter-caltechthesis | 2 | 0 % |
| photoionizationdynamicsandionstatedistributionsinsingle-photonandresonanceenhancedmultiphotonionizationofmolecules-caltechthesis | 2 | 0 % |
| earthquake geology of myanmar phd thesis yu wang califonia institute of technology 2013 pg 317 | 2 | 0 % |
| rowena lohman | 2 | 0 % |
| potentiometer theory | 2 | 0 % |
| molybdenum -rhenium alloys superconduct at 10k | 2 | 0 % |
| itemswhereoptionis astronomy andyearis1987-caltechthesis | 2 | 0 % |
| investigationofcompositesofcarbonblackandmetallocycles andfunctionalizedtransition-metalnanoparticlesaschemiresistivevaporsensors-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/8654/7/asimakopoulos-a-2015-thesis.pdf | 2 | 0 % |
| newphasesoftwo-dimensionalelectronsinexcitedlandaulevels-caltechthesis | 2 | 0 % |
| schedulingforheavy-tailedandlight-tailedworkloadsinqueueingsystems-caltechthesis | 2 | 0 % |
| applicationsofamethodfortheanalysesofmany-electronwavefunctions-caltechthesis | 2 | 0 % |
| shock-waveprocessingofpowdermixtures-caltechthesis | 2 | 0 % |
| itemswhereoptionis materialsscience andyearis2008-caltechthesis | 2 | 0 % |
| parti.theoreticalcalculationsofequilibriuminfraredgasemissivitiesfromspectroscopicdata.partii.representativeradiativeenergytransfercalculationsfortransparentandopticallydensemedia-caltechthesis | 2 | 0 % |
| acknowledgement to parents in thesis | 2 | 0 % |
| multiscale methods for elliptic partial differential equations and related applications | 2 | 0 % |
| caltech alkylating bacteria | 2 | 0 % |
| clustersofgalaxiesandthecosmiclight-caltechthesis | 2 | 0 % |
| aquantitativeanalysisoftheatmospheresofthreepeculiarlow-luminositybstars-caltechthesis | 2 | 0 % |
| dorsal-ventralpatterningandgeneregulationintheearlyembryoofdrosophilamelanogaster-caltechthesis | 2 | 0 % |
| site-specificincorporationofunnaturalaminoacidsintoreceptorsexpressedinmammaliancells-caltechthesis | 2 | 0 % |
| seismic response modeling of multi-story | 2 | 0 % |
| site caltech.edu graphene fet | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2007-05 -main | 2 | 0 % |
| vlf antenna transmitter | 2 | 0 % |
| lowenergyion-surfaceinteractionandepitaxialgrowthinthesigesystem-caltechthesis | 2 | 0 % |
| crystal plasticity hydrogen embrittlement | 2 | 0 % |
| homotopyandhomologyofp-subgroupcomplexes-caltechthesis | 2 | 0 % |
| itemswhereyearis1970-caltechthesis | 2 | 0 % |
| samanta padalino | 2 | 0 % |
| thermalrearrangementsofsmallringhydrocarbons.photosensitizedrearrangementsofsmallringhydrocarbons-nonverticalenergytransfer-caltechthesis | 2 | 0 % |
| simulationofdynamicinterfacefractureusingspectralboundaryintegralmethod-caltechthesis | 2 | 0 % |
| latitude effect of cosmic rays | 2 | 0 % |
| nonsteadycrackpropagationandcrazebehaviorinpmma-caltechthesis | 2 | 0 % |
| dynamics of blood circulation in a mammal | 2 | 0 % |
| somehightemperatureoxidationcharacteristicsofnickelwithchromiumadditions-caltechthesis | 2 | 0 % |
| dissimilativefe iii reductionbypseudomonassp.200-caltechthesis | 2 | 0 % |
| theearlyeventsofproteinfolding simulationsofpolyalaninefoldingintoanalpha-helix-caltechthesis | 2 | 0 % |
| nano-liquid | 2 | 0 % |
| studiesintheflowofgranularmaterials-caltechthesis | 2 | 0 % |
| active oxide nanophotonics | 2 | 0 % |
| internalfrictioninmetals-caltechthesis | 2 | 0 % |
| solar micromave emission | 2 | 0 % |
| charge-transferassociationinenzymeinhibition-caltechthesis | 2 | 0 % |
| topicsingeneralrelativity binaryblackholesandhyperbolicformulationsofeinstein sequations-caltechthesis | 2 | 0 % |
| an experimental investigation of scalar mixing in supersonic turbulent shear layers | 2 | 0 % |
| excitation of modes in circular waveguides | 2 | 0 % |
| effect of cooling rate gamma alpha transformation pure iron | 2 | 0 % |
| somephotochemistryofmaleicanhydride;theadditiontobenzeneandthedimerization-caltechthesis | 2 | 0 % |
| matlab code fluorescence correlation spectroscopy | 2 | 0 % |
| itemswhereoptionis physics andyearis1984-caltechthesis | 2 | 0 % |
| investigationofspininjectionandopticalimagingwithscanningprobemicroscopytechniques-caltechthesis | 2 | 0 % |
| combustion stochastic | 2 | 0 % |
| phd acknowledgements | 2 | 0 % |
| utilizationofsilicidesforvlsi-contactswithaluminumandthermaloxidation-caltechthesis | 2 | 0 % |
| discriminatory auction multiple units differential equilibrium | 2 | 0 % |
| stone_ha_1988 | 2 | 0 % |
| itemswhereoptionis computerscience andyearis1999-caltechthesis | 2 | 0 % |
| flow cylinder rotary | 2 | 0 % |
| w | 2 | 0 % |
| large aspect ratio 2d turbulence | 2 | 0 % |
| geologyandoredepositsofapartofthepanamintrange california-caltechthesis | 2 | 0 % |
| itemswhereoptionis physics -caltechthesis | 2 | 0 % |
| ultrafastelectroncrystallography principlesandapplications-caltechthesis | 2 | 0 % |
| thehst/lcomeasurementofthemeanfluxoftheextragalacticbackgroundlight 3000-800003 -caltechthesis | 2 | 0 % |
| thedeterminationofcarbondioxideinfermentingmixtures.co-zymase astudyofpurificationmethods-caltechthesis | 2 | 0 % |
| howard kabakow | 2 | 0 % |
| data of photochemical smog | 2 | 0 % |
| semi-containedinteractionsofatmosphericneutrinosinthemacrodetector-caltechthesis | 2 | 0 % |
| synthesisofpwmdc-to-dcpowerconverters-caltechthesis | 2 | 0 % |
| itemswhereoptionis controlanddynamicalsystems andyearis2006-caltechthesis | 2 | 0 % |
| chronocoulometry | 2 | 0 % |
| basepressureatsupersonicvelocities-caltechthesis | 2 | 0 % |
| groups with maximal center index | 2 | 0 % |
| laboratorystudiesofatmosphericreactionsusinginfraredcavityringdownspectroscopy-caltechthesis | 2 | 0 % |
| n-body methods | 2 | 0 % |
| analysisofdrosophilafibroblastgrowthfactorfunctionaldomains-caltechthesis | 2 | 0 % |
| problemsinanalysisanddesignofswitchingregulators i.poleplacementtechniquefordc-to-dcswitchingregulators.ii.transformermodelling.iii.cross-regulationofthetwo-outputcukconverter-caltechthesis | 2 | 0 % |
| oneandtwo-dimensionaldigitalmutiratesystemswithapplicationsinsub-samplingandbandlimitedsignalreconstruction-caltechthesis | 2 | 0 % |
| 1 glycoproteinsanddevelopmentinthecellularslimemolddictyosteliumdiscoideum. 2 separationofcellsusingisopycniccentrifugationinlineardensitygradientsofcolloidalsilica-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-05 -osdetail | 2 | 0 % |
| i interannualvariabilityofstratosphericozoneandtemperature.ii seasonalcycleofn2o-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-07 -errors404 | 2 | 0 % |
| uncooled carbon microbolometer imager | 2 | 0 % |
| analysisofneuronaldynamicsinbehavinganimals-caltechthesis | 2 | 0 % |
| measurementofabsolutef-valuesofirongroupelements-caltechthesis | 2 | 0 % |
| theoryofplasmawaveresonancesinahotnonuniformplasma-caltechthesis | 2 | 0 % |
| wiringconsiderationsinanalogvlsisystems withapplicationtofield-programmablenetworks-caltechthesis | 2 | 0 % |
| molecularmodelingofbiologicalsystems fromchitinaseatoz-dna-caltechthesis | 2 | 0 % |
| long wave equations synolakis | 2 | 0 % |
| studiesofgrignardreagentrearrangementsbymeansofnuclearmagneticresonancespectroscopy.i.thestructureofallylicgrignardreagents.ii.theinterconversionofcyclopropylcarbinylandallylcarbinylgrignardreagents-caltechthesis | 2 | 0 % |
| electron drift velocity in silicon | 2 | 0 % |
| the conduction band edge ecb of a semiconductor x ec − 1/2 eg | 2 | 0 % |
| olsr multiple channel thesis | 2 | 0 % |
| experimental investigation of acoustic oscillations over cavities | 2 | 0 % |
| studiesofthermalandphysicalpropertiesofhydrocarbons-caltechthesis | 2 | 0 % |
| experimentalstudyofthereattachmentpressureriseatsubsonicspeeds-caltechthesis | 2 | 0 % |
| geologyandquicksilverdepositsofthecosohotspringsarea inyocounty california-caltechthesis | 2 | 0 % |
| geological tophography of myanmar | 2 | 0 % |
| astudyofthetrailingvorticesbehindaringwing-caltechthesis | 2 | 0 % |
| determinationoftherelativelinestrengthsofthea^2a x^2a and 200 000 transitionsofho_2-caltechthesis | 2 | 0 % |
| iii-vmolecularbeamepitaxystructuresforelectronicandoptoelectronicapplications-caltechthesis | 2 | 0 % |
| peptidylacylatingagentsinthepupaeofdrosophilamelanogasterandtheirpossiblerelationshiptoproteinsynthesis-caltechthesis | 2 | 0 % |
| photodisintegrationofthedeuteron-caltechthesis | 2 | 0 % |
| sbi general formula in polymer chemist | 2 | 0 % |
| spiketraincharacterizationanddecodingforneuralprostheticdevices-caltechthesis | 2 | 0 % |
| itemswhereoptionis socialscience andyearis2009-caltechthesis | 2 | 0 % |
| bianchi type universe | 2 | 0 % |
| sidewall friction vibration | 2 | 0 % |
| evaporation rate of hydrazine | 2 | 0 % |
| protein thermostability and engineering | 2 | 0 % |
| numericalstudyofpatternformingprocessesinmodelsofrotatingrayleigh-bnardconvection-caltechthesis | 2 | 0 % |
| table of contents phd thesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-03 -keywords | 2 | 0 % |
| rotordynamicforcesgeneratedbydischarge-to-suctionleakageflowsincentrifugalpumps-caltechthesis | 2 | 0 % |
| receivebufferdynamicsandosscheduling-caltechthesis | 2 | 0 % |
| anearly-quadraticgapbetweenadaptiveandnon-adaptivepropertytesters-caltechthesis | 2 | 0 % |
| airline inputs | 2 | 0 % |
| ananalogvlsiarchitectureforstereocorrespondence-caltechthesis | 2 | 0 % |
| itemswhereoptionis astronomy andyearis1977-caltechthesis | 2 | 0 % |
| ketan vyas caltech | 2 | 0 % |
| voltagegateableionicporesinducedbyalamethicininblacklipidmembranes-caltechthesis | 2 | 0 % |
| characteristicsoftherocketmotorandflightanalysesofthesoundingrocket-caltechthesis | 2 | 0 % |
| responseofmechanicalsystemstorandomexcitation-caltechthesis | 2 | 0 % |
| itemswhereoptionis chemistry andyearis1966-caltechthesis | 2 | 0 % |
| geologyofthest.francisdamarea losangelescounty california-caltechthesis | 2 | 0 % |
| a high_speed schlieren investigation of diffuser flows | 2 | 0 % |
| aninvestigationofcontouredwallinjectorsforhypervelocitymixingaugmentation-caltechthesis | 2 | 0 % |
| frequencydependentelectromagneticfields modelsappropriateforthebrain-caltechthesis | 2 | 0 % |
| ohmiccontactstobetasiliconcarbide electricalandmetallurgicalcharacterizations-caltechthesis | 2 | 0 % |
| effect diluents on burning velocity pdf | 2 | 0 % |
| theoreticalinvestigationsofsolidinterfaces 1.thepositionofthefermilevelatametal-semiconductorinterface.2.geometriclatticematchanditsapplicationtoheteroepitaxy.3.ab-initiocalculationoftheelasticpropertiesofsilicon usingsmallclusters-caltechthesis | 2 | 0 % |
| steelmoment-resistingframeresponsesinsimulatedstronggroundmotions orhowilearnedtostopworryingandlovethebigone-caltechthesis | 2 | 0 % |
| analysisofupperandlowermantlestructureusingshearwaves-caltechthesis | 2 | 0 % |
| directmeasurementoflaminarskinfrictionathypersonicspeeds-caltechthesis | 2 | 0 % |
| dyesensitizationofnanocrystallinetitaniumdioxidewithosmiumandrutheniumpolypyridinecomplexes-caltechthesis | 2 | 0 % |
| thesis related blow up of the solution | 2 | 0 % |
| aircraft design thesis edu.de | 2 | 0 % |
| binarygalaxiesandgroupsofgalaxies-caltechthesis | 2 | 0 % |
| groundvibrationsnearexplosions-caltechthesis | 2 | 0 % |
| terahertz time-domain spectroscopy of ices of n2 co2 | 2 | 0 % |
| mechanism of boiling | 2 | 0 % |
| silver nanoparticles cross blood-brain barrier | 2 | 0 % |
| itemswhereoptionis electricalengineering andyearis2003-caltechthesis | 2 | 0 % |
| thekineticsoftheexchangeofradioactivehydrogenbetweenhypophosphorousacidandwater.aninvestigationofsomeaspectsofthechemistryofhypophosphorousacidandthalloushypophosphite.anewassaymethodfortritiatedwater-caltechthesis | 2 | 0 % |
| odor source localization thesis | 2 | 0 % |
| itemswhereoptionis physics andyearis1968-caltechthesis | 2 | 0 % |
| compressive strength of sheet metal | 2 | 0 % |
| studiesingravitationallensingandnumericalhydrodynamics-caltechthesis | 2 | 0 % |
| final thesis of students of control systems pdf | 2 | 0 % |
| modelingoftectonicprocessesassociatedwithearthquakes-caltechthesis | 2 | 0 % |
| pipe helical coil pressure drop pdf | 2 | 0 % |
| transportofroot-forminghormoneinwoodycuttings-caltechthesis | 2 | 0 % |
| sample acknowledgement of thesis | 2 | 0 % |
| mohr circle fracture | 2 | 0 % |
| itemswhereoptionis socialscience andyearis1995-caltechthesis | 2 | 0 % |
| highprecisionthorium-230agesofcoralsandthetimingofsealevelfluctuationsinthelatequaternary-caltechthesis | 2 | 0 % |
| electromagneticwavepropagationinalmostperiodicmedia-caltechthesis | 2 | 0 % |
| thesis网站 | 2 | 0 % |
| analysisofapertureantennasininhomogenousmedia-caltechthesis | 2 | 0 % |
| measurementsoffluctuatingairloadsonacircularcylinder-caltechthesis | 2 | 0 % |
| thestabilityofrelativistic sphericallysymmetricstarclusters-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-09 -allrobots | 2 | 0 % |
| parti.exploratoryinvestigationoftheautoxidationandhydrationof3-hexynecatalyzedbymercuricsulfateandsulfuricacid.partii.theeffectofmercuricnitrateandotherelectrolytesupontheaqueoussolubilityofbenzene.partiii.coordinationofpolycyclicaromatichydrocarbonswithsilverion;correlationofequilibriumconstantswithrelativecarcinogenicpotencies-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-05 -urlexit | 2 | 0 % |
| thesignificanceofvortexringformationandnozzleexitover-pressuretopulsatilejetpropulsion-caltechthesis | 2 | 0 % |
| differentialweatheringeffectsandmechanisms-caltechthesis | 2 | 0 % |
| old faithful origin | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-04 -urlentry | 2 | 0 % |
| anewapproachtotheanalysisoflargedeflectionsofplates-caltechthesis | 2 | 0 % |
| crltoris | 2 | 0 % |
| theelectricalpropertiesofnanoscaleparallelsemiconductorinterfaces-caltechthesis | 2 | 0 % |
| usion | 2 | 0 % |
| theory and applications of hyper redundant robotic mechanisms | 2 | 0 % |
| sequencespecificdnarecognitionandbending-caltechthesis | 2 | 0 % |
| dynamicalsignaturesofgearboxvibrations-caltechthesis | 2 | 0 % |
| theinvestigationofgas-phaseion-moleculereactionswithfouriertransformioncyclotronresonancemassspectrometry-caltechthesis | 2 | 0 % |
| itemswhereoptionis chemistry andyearis1923-caltechthesis | 2 | 0 % |
| amir safaripour | 2 | 0 % |
| autism and the gut brain connection dissertation | 2 | 0 % |
| dissertation roadmap pdf | 2 | 0 % |
| plasmonicnanoparticlesforoptofluidicapplications-caltechthesis | 2 | 0 % |
| itemswhereoptionis biology andyearis1980-caltechthesis | 2 | 0 % |
| single unit in vivo rats | 2 | 0 % |
| theatomicstructureofsomemetallicglassesandtheinfluenceofthepreparationtechniqueontheamorphousstate-caltechthesis | 2 | 0 % |
| itemswhereoptionis mechanicalengineering andyearis1990-caltechthesis | 2 | 0 % |
| aninvestigationoftheuseoffeedbackcontroltoraisetheflutterspeedofanaeroelasticsystem-caltechthesis | 2 | 0 % |
| topicsinintegralmatricesandabeliangroupcodes-caltechthesis | 2 | 0 % |
| conclusion for superconductivity | 2 | 0 % |
| spatial deployable structure tape spring | 2 | 0 % |
| liquidsloshinginanelasticcontainer-caltechthesis | 2 | 0 % |
| rationaldesignofanewclassofcyclodextrin-containingpolymersforgenedelivery-caltechthesis | 2 | 0 % |
| interlockedmoleculesusingolefinmetathesis-caltechthesis | 2 | 0 % |
| biosensors pdf | 2 | 0 % |
| thechemistryoftris phosphino boratemanganeseandironplatforms-caltechthesis | 2 | 0 % |
| constant-pressurelaminarmixingofashearlayerwithaquiescentfluid-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/5190/ | 2 | 0 % |
| mechanical properties metallic glass thesis | 2 | 0 % |
| studyofelectrictransientsinthevacuumswitchbymeansofthecathoderayoscillograph-caltechthesis | 2 | 0 % |
| analysis failure compression laminate composite | 2 | 0 % |
| itemswhereoptionis chemistry andyearis1944-caltechthesis | 2 | 0 % |
| progress in millimeter wave integrated-circuit imaging antenna arrays | 2 | 0 % |
| http //thesis.library.caltech.edu/605/ | 2 | 0 % |
| what ere disaventage of unlabeling of samples in medical laboratory | 2 | 0 % |
| theevaluationofe-kcurvesfromtunnelingcurrents-caltechthesis | 2 | 0 % |
| solutionadaptivemeshproceduresforthenumericalsolutionofsingularperturbationproblems-caltechthesis | 2 | 0 % |
| studiesofrotordynamicforcesgeneratedbyannularflows-caltechthesis | 2 | 0 % |
| ultrafastdynamicsofbarriercrossing step-wisesolvationeffectonisomerizationoftrans-stilbeneinalkaneclusters-caltechthesis | 2 | 0 % |
| theconservationlawsofthreedimensionallinearizedelasticitytheory-caltechthesis | 2 | 0 % |
| thecellularuptakeofluminescentrutheniumcomplexes-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/2907/ | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-02 -lasthosts | 2 | 0 % |
| studiesonaminoacidactivationandproteinsynthesis-caltechthesis | 2 | 0 % |
| somepropertiesoftheionosphereatlowradiofrequencies-caltechthesis | 2 | 0 % |
| intio3 | 2 | 0 % |
| investigationsofspontaneouscondensationphenomena-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-03 -urlentry | 2 | 0 % |
| silicon mems for fluidics | 2 | 0 % |
| thecrystalstructureofzunyite-caltechthesis | 2 | 0 % |
| i.fluidflowinaprecessingsphericalcavity.ii.electromagneticradiationfromanexpandingsphereinamagneticfield-caltechthesis | 2 | 0 % |
| ttfa and mitochondrial complexii. | 2 | 0 % |
| boiling mechanism | 2 | 0 % |
| theidentificationofstablereactionintermediatesonaluminumoxidesurfaceswithinelasticelectrontunnelingspectroscopy-caltechthesis | 2 | 0 % |
| predictionofstructuresandpropertiesfororganicsuperconductors-caltechthesis | 2 | 0 % |
| studiesontheon-lineidentificationandoptimalcontrolofbioreactors-caltechthesis | 2 | 0 % |
| asymmetricorganocatalysisincomplextargetsynthesis progresstowardsthetotalsynthesisofdiazonamidea-caltechthesis | 2 | 0 % |
| lifeinextremeenvironments lanthanide-baseddetectionofbacterialsporesandothersensordesignpursuits-caltechthesis | 2 | 0 % |
| mean free path model for gas diffusion | 2 | 0 % |
| nitrogeninjectionintothebaseregionofahypersonicwake-caltechthesis | 2 | 0 % |
| hot surface ignition | 2 | 0 % |
| modesuperpositionmethodsappliedtolinearmechanicalsystemsunderearthquaketypeexcitation-caltechthesis | 2 | 0 % |
| tetrazole carbene | 2 | 0 % |
| relativef-valuesofselectedlinesintheabsorptionspectrumofchromiumi-caltechthesis | 2 | 0 % |
| thesis of mint | 2 | 0 % |
| stability | 2 | 0 % |
| neotectonicsofthenorthfrontalfaultsystemofthesanbernardinomountains southerncalifornia cajonpasstolucernevalley-caltechthesis | 2 | 0 % |
| melanie yen and caltech | 2 | 0 % |
| huesegmentation colorcircuitry andthemantisshrimp-caltechthesis | 2 | 0 % |
| bubbledynamicsandbreakupinstrainingflows-caltechthesis | 2 | 0 % |
| free ph.d. thesis on human genomic diversity | 2 | 0 % |
| physicsandchemistryofsiliconsurfacepassivation-caltechthesis | 2 | 0 % |
| 02050100070404 | 2 | 0 % |
| bmg pillar toughness | 2 | 0 % |
| growthandapplicationsofphotorefractivepotassiumlithiumtantalateniobate kltn -caltechthesis | 2 | 0 % |
| effectofsingleandperiodicdisturbancesonintermittencyinpipeflow-caltechthesis | 2 | 0 % |
| understanding molecular flow regions and viscous flow regions mass spec vacuum | 2 | 0 % |
| ni80fe20 | 2 | 0 % |
| aninvestigationoftheinterferenceeffectsofastingsupportsystemonthepressuredistributionoverabodyofrevolution-caltechthesis | 2 | 0 % |
| recognitionofnucleicacidmismatchesbyluminescentrutheniumcomplexes-caltechthesis | 2 | 0 % |
| geologyofthesantamonicamountains westofthemaliburanch venturacounty california-caltechthesis | 2 | 0 % |
| hydrogen storage methods pdf | 2 | 0 % |
| studiesofphotochemicalandphotophysicalprocesses-caltechthesis | 2 | 0 % |
| theory of gaseous diffusion coefficient.com | 2 | 0 % |
| placerita fault | 2 | 0 % |
| cuprous halides | 2 | 0 % |
| welcometocaltechthesis-caltechthesis | 2 | 0 % |
| somephilippineuppertertiaryforaminifer-caltechthesis | 2 | 0 % |
| stereoselectiveruthenium-catalyzedolefinmetathesis-caltechthesis | 2 | 0 % |
| bianchitypeicosmologicalmodels-caltechthesis | 2 | 0 % |
| observationsoncavitationbubblecollapse-caltechthesis | 2 | 0 % |
| linearandnonlinearacousticswithnonuniformentropyincombustionchambers-caltechthesis | 2 | 0 % |
| bootstraptheoryandcertainpropertiesofthehadronaxialvectorcurrent-caltechthesis | 2 | 0 % |
| anoperatortheoryapproachtononlinearcontrollerdesign-caltechthesis | 2 | 0 % |
| when to use taylor series expansion in optimization | 2 | 0 % |
| astudyofdistortionsinacloudchamber-caltechthesis | 2 | 0 % |
| broadbandwaveformmodelinganditsapplicationtothelithosphericstructureofthetibetanplateau-caltechthesis | 2 | 0 % |
| themosesrockdike geology petrologyandmodeofemplacementofakimberlite-bearingbrecciadike sanjuancounty utah-caltechthesis | 2 | 0 % |
| flow circular cone | 2 | 0 % |
| itemswhereoptionis aeronautics -caltechthesis | 2 | 0 % |
| theory of holography | 2 | 0 % |
| an experimental study of acoustically excited vortex driven smith caltech phd thesis | 2 | 0 % |
| ellipticcombinatoricsandmarkovprocesses-caltechthesis | 2 | 0 % |
| aerodynamicandgeometricparametersaffectingaircraftweight-caltechthesis | 2 | 0 % |
| molecular reaction dynamics | 2 | 0 % |
| dislocationvelocityandsliponthe 1 21 2 12 13 systemsofzinc-caltechthesis | 2 | 0 % |
| itemswhereoptionis environmentalscienceandengineering andyearis1991-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-02 -allrobots | 2 | 0 % |
| cal tech barium | 2 | 0 % |
| studiesoflevitatedsingledroplets-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-12 -osdetail | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-08 -refererpages | 2 | 0 % |
| understandingthechemicalbasisofneuronaldevelopmentandcommunication i.theroleoffucosealpha 1-2 galactosecarbohydratesinneuronalgrowthii.structure-functionanalysisofchondroitinsulfateinthebrain-caltechthesis | 2 | 0 % |
| phugoid | 2 | 0 % |
| patrick lee physics letters 1980 4 46 | 2 | 0 % |
| stochasticcharacterizationofstronggroundmotionandapplicationstostructuralresponse-caltechthesis | 2 | 0 % |
| itemswhereoptionis geology andyearis1947-caltechthesis | 2 | 0 % |
| geologyofareanearsunland california-caltechthesis | 2 | 0 % |
| structureofthenorthwesternpuentehills losangelescounty california-caltechthesis | 2 | 0 % |
| mechanism of boiling water | 2 | 0 % |
| chrono coulometric technique pdf | 2 | 0 % |
| applicationofwell-loggingmethodstoshotholes-caltechthesis | 2 | 0 % |
| observationsofoscillatorymotionsinthesolaratmosphere-caltechthesis | 2 | 0 % |
| studiesofnovelmethodsofgenetransferandgeneregulationineukaryoticcells-caltechthesis | 2 | 0 % |
| hypervelocity flow over spheres | 2 | 0 % |
| landing gear spin-up | 2 | 0 % |
| experimentalinvestigationoftheeffectofanelectricfieldontheviscosityofliquids-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/1642/ | 2 | 0 % |
| problems with metals in construction | 2 | 0 % |
| ageneticandcytologicalanalysisofatandemduplicationanditsincludedlociindrosophilamelanogaster-caltechthesis | 2 | 0 % |
| manifolds computer science | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis1983-caltechthesis | 2 | 0 % |
| thin cylindrical shell | 2 | 0 % |
| optimizednetworkdatastorageandtopologycontrol-caltechthesis | 2 | 0 % |
| magnetohydrodynamicmodelingofsolarmagneticarcadesusingexponentialpropagationmethods-caltechthesis | 2 | 0 % |
| the contribution of biomass combustion to ambient fine particulate concentrations in the united states | 2 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis1992-caltechthesis | 2 | 0 % |
| itemswhereoptionis mathematics andyearis1949-caltechthesis | 2 | 0 % |
| outer-sphereeffectsonthecoppersitesofpseudomonasaeruginosaazurins-caltechthesis | 2 | 0 % |
| tip clearance axial flow pump | 2 | 0 % |
| synthesisofthe-ketoimidesandtheirchemicaltransformations-caltechthesis | 2 | 0 % |
| gravitygradiometerdatareduction-caltechthesis | 2 | 0 % |
| process for the preparation of oxalic acid | 2 | 0 % |
| http //thesis.library.caltech.edu/7543/ | 2 | 0 % |
| propertiesofpiezoresistivesiliconnano-scalecantileverswithapplicationstobionems-caltechthesis | 2 | 0 % |
| i.imidazolecompoundsaccumulatedbypurinemutantsofneurosporacrassa.ii.complementationstudieswithisoleucine-valinemutantsofneurosporacrassa-caltechthesis | 2 | 0 % |
| preliminarydesignstudyofacentrifugaljetenginewithasupersonicpropeller-caltechthesis | 2 | 0 % |
| the2-lengthofafinitesolvablegroup-caltechthesis | 2 | 0 % |
| investigatingmoralevents characterizationandstructureofautobiographicalmoralmemories-caltechthesis | 2 | 0 % |
| fluctuating intensity in wake | 2 | 0 % |
| galactic cosmic ray ionization rate | 2 | 0 % |
| thediversityofneutronstars nearbythermallyemittingneutronstarsandthecompactcentralobjectsinsupernovaremnants-caltechthesis | 2 | 0 % |
| ch3sch3 | 2 | 0 % |
| thethermaldecompositionofozone.evidenceoftheexistenceofactivatedmoleculesinachemicalreaction.possiblelimitsfortheheatofdissociationofoxygen-caltechthesis | 2 | 0 % |
| twomechanismsofvorticitygenerationincombustingflowfields-caltechthesis | 2 | 0 % |
| effects of combustion chamber blockage on bluff body flame stabilization | 2 | 0 % |
| geologyandmineralizationconnectedwiththeintrusionofaquartzmonzoniteporphyry ironmountain ironspringsdistrict utah-caltechthesis | 2 | 0 % |
| dynamicresponseofcavitationturbomachines-caltechthesis | 2 | 0 % |
| thescatteringofelectronsingases-caltechthesis | 2 | 0 % |
| hiobservationsofdustclouds-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-03 -unknownos | 2 | 0 % |
| parti.thestabilityofamembraneinasubsonicflow.partii.thestabilityofagridofpanelsinasupersonicflow-caltechthesis | 2 | 0 % |
| transferatc.eleganssynapses-caltechthesis | 2 | 0 % |
| bachelor s thesis caltech | 2 | 0 % |
| thermodynamic activity oxide | 2 | 0 % |
| quantumtheoryofcoupledsystemshavingapplicationtomasers-caltechthesis | 2 | 0 % |
| itemswhereoptionis physics andyearis1944-caltechthesis | 2 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis1975-caltechthesis | 2 | 0 % |
| photosystem | 2 | 0 % |
| gnotobiotic mice mechanisms | 2 | 0 % |
| effectsofcontrolledthree-dimensionalperturbationsonboundarylayertransition-caltechthesis | 2 | 0 % |
| itemswhereoptionis appliedphysics andyearis2010-caltechthesis | 2 | 0 % |
| what is the utility of palladium | 2 | 0 % |
| teleseismicallydeterminedsourceparametersofseverallargecollision-zoneearthquakes-caltechthesis | 2 | 0 % |
| renaturation and denaturation kinetics | 2 | 0 % |
| experimental phase thesis | 2 | 0 % |
| olefinmetathesiswithgroupviiitransitionmetalcomplexes mechanism reactivity andcatalystdevelopment-caltechthesis | 2 | 0 % |
| chromatiaceae arctic | 2 | 0 % |
| itemswhereoptionis physics andyearis1996-caltechthesis | 2 | 0 % |
| micromachinery and microfabrication | 2 | 0 % |
| xuan an efficient semi-implicit time-integration scheme for stiff chemical source terms | 2 | 0 % |
| sandston meteorite | 2 | 0 % |
| studiesofoverlayervibrationalstructureandidentificationofadsorbedreactionintermediatesviaelectronenergylossspectroscopy-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/6232/1/jld_thesis_revised.pdf | 2 | 0 % |
| i.nonlineargasoscillationsinpipes.ii.wavetrainswithsmalldissipation.-caltechthesis | 2 | 0 % |
| theconvectivediffusionofoxygen carbondioxideandinertgasinblood-caltechthesis | 2 | 0 % |
| astudyofheattransportprocessesinthewakeofastationaryandoscillatingcircularcylinderusingdigitalparticleimagevelocimetry/thermometry-caltechthesis | 2 | 0 % |
| aerosol hotspots lungs | 2 | 0 % |
| microwaveandfar-infraredspectroscopyofwater-containing hydrogen-bondeddimers vibrational rotational andtunnelingdynamics-caltechthesis | 2 | 0 % |
| compressedsensing sparseapproximation andlow-rankmatrixestimation-caltechthesis | 2 | 0 % |
| geologyofanorthernportionofthesunlandquadrangle losangelescounty-caltechthesis | 2 | 0 % |
| binding site of dopamine | 2 | 0 % |
| dynamics acousticsandcontrolofcloudcavitationonhydrofoils-caltechthesis | 2 | 0 % |
| theoreticalandcomputationalstudiesofisotropichomogeneousturbulence-caltechthesis | 2 | 0 % |
| joanna austin caltech | 2 | 0 % |
| primarycosmicrayelectronsandalbedoelectronsin1967atenergiesbetween12and1000mev-caltechthesis | 2 | 0 % |
| theeffectofacircularholeonthebucklingofcylindricalshells-caltechthesis | 2 | 0 % |
| thestratigraphyandforaminiferalfaunaofthesantasusanaformation-caltechthesis | 2 | 0 % |
| theoreticalstudiesofphotoionization-caltechthesis | 2 | 0 % |
| ionizationstructureandemissionlineintensitiesofseyfertgalaxynuclei-caltechthesis | 2 | 0 % |
| studiesindynamics-caltechthesis | 2 | 0 % |
| poore stability bifurcation reactor | 2 | 0 % |
| split brain surgery | 2 | 0 % |
| cmt nias and simeulue island | 2 | 0 % |
| electronicstructuresandreactivitypatternsofdipalladium ii ii anddiplatinum ii ii complexes-caltechthesis | 2 | 0 % |
| moleculardynamics md studiesonphasetransformationanddeformationbehaviorsinfccmetalsandalloys-caltechthesis | 2 | 0 % |
| hypersonicflowoveranellipticcone theoryandexperiment-caltechthesis | 2 | 0 % |
| logit economic voting | 2 | 0 % |
| flame stabilization using bluff bodies | 2 | 0 % |
| pheromonesinfree-livingandparasiticnematodes-caltechthesis | 2 | 0 % |
| themanufactureoftungsticacidfromscheelite-caltechthesis | 2 | 0 % |
| whispering galler mode/ewaonator | 2 | 0 % |
| particlecollisionsandcoalescenceinfluids-caltechthesis | 2 | 0 % |
| thestructureofstronginteractionsymmetries-caltechthesis | 2 | 0 % |
| aurora and the ionosphere | 2 | 0 % |
| methodsfortheanalysisoforganicchemistryontitan-caltechthesis | 2 | 0 % |
| srivatsan hulikal | 2 | 0 % |
| phototransduction priciples t delbruck | 2 | 0 % |
| dynamicalmodelofthesigmahyperon-caltechthesis | 2 | 0 % |
| ironintheocean laboratoryexperimentsofirongeochemistryinthepresenceofmarineparticles-caltechthesis | 2 | 0 % |
| impedance pump cardiovascular | 2 | 0 % |
| geologyofthejacksonmountains northwestnevada-caltechthesis | 2 | 0 % |
| topicsinmillimeter-waveimagingarrays-caltechthesis | 2 | 0 % |
| proton beam production | 2 | 0 % |
| theroleoffilamininthemorphogenesisoftheskeletalmusclesarcomere-caltechthesis | 2 | 0 % |
| two-dimensionalirrotationalmixedsubsonicandsupersonicflowofacompressiblefluidandtheuppercriticalmachnumber-caltechthesis | 2 | 0 % |
| fabricationandtestingofnbn/mgo/nbntunneljunctionsforuseashigh-frequencyheterodynedetectors-caltechthesis | 2 | 0 % |
| marie-agnes allard | 2 | 0 % |
| parti.experimentalinvestigationofanarc-heatedsupersonicfreejet.partii.analysisofone-dimensionalisentropicflowforpartiallyionizedargon-caltechthesis | 2 | 0 % |
| evolutionofemissionlinegalaxies-caltechthesis | 2 | 0 % |
| interactionsbetweengalaxiesandahotmediuminrichclusters-caltechthesis | 2 | 0 % |
| renieramycin o | 2 | 0 % |
| itemswhereoptionis astrophysics andyearis2008-caltechthesis | 2 | 0 % |
| investigationoftheroleofhydridesinzirconocenecatalyzedolefinpolymerization-caltechthesis | 2 | 0 % |
| generalizationerrorestimatesandtrainingdatavaluation-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-12 -refererpages | 2 | 0 % |
| title page thesis in confined spaces | 2 | 0 % |
| numericalsimulationofwavefocusingandscatteringinshockwavelithotripsy-caltechthesis | 2 | 0 % |
| cal tech dissertation 2014 | 2 | 0 % |
| optomechanically induced transparency unresolved | 2 | 0 % |
| some thesis about neptune | 2 | 0 % |
| analysisandcontrolofquasidistributedparametersystems-caltechthesis | 2 | 0 % |
| theconductofbasicresearchintheaerospaceindustry-caltechthesis | 2 | 0 % |
| topological analysis of turbulence vortex | 2 | 0 % |
| dna sensor and effect of overhang | 2 | 0 % |
| secondsoundattenuationinaliquidheliumcounterflowjet-caltechthesis | 2 | 0 % |
| themechanismoftripletenergytransferinsolution thequenchingofexcited-statebenzophenonebytransition-metalchelates-caltechthesis | 2 | 0 % |
| microfluidics mems peristaltic | 2 | 0 % |
| recent phd thesis related to quasi resonant inverter with application | 2 | 0 % |
| woundhealingonartificialextracellularmatrixproteins-caltechthesis | 2 | 0 % |
| circlepatterns energyminimization.hsourcefile | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-03 -main | 2 | 0 % |
| theburningofsingledropsoffuelinoxidizingatmospheres-caltechthesis | 2 | 0 % |
| thehelix-coiltransitionindna effectsoftheinteractionswithsmallionsandofthecompositionofdna-caltechthesis | 2 | 0 % |
| images rocks and minerals riverside county ca | 2 | 0 % |
| alpha-particlesfromboron12 theastrophysicalsignificance-caltechthesis | 2 | 0 % |
| thedownwashdistributionbehindadeltawingatsupersonicspeeds-caltechthesis | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis1975-caltechthesis | 2 | 0 % |
| thetreemachine ahighlyconcurrentcomputingenvironment-caltechthesis | 2 | 0 % |
| what is phoresy? wikipedia | 2 | 0 % |
| bifurcationsinkolmogorovandtaylor-vortexflows-caltechthesis | 2 | 0 % |
| anewspinonhorizontal-branchstars anomalousabundancesandrapidrotationrates-caltechthesis | 2 | 0 % |
| dynamicsheardeformationinzinccrystals-caltechthesis | 2 | 0 % |
| particle interaction region or zone | 2 | 0 % |
| anelectronforcefieldforsimulatinglargescaleexcitedelectrondynamics-caltechthesis | 2 | 0 % |
| Ì¥¼Ç | 2 | 0 % |
| 1h nmf of bis sulfonate | 2 | 0 % |
| structural stratigraphic andgeochronologicanalysisofthealexander-takuterraneboundaryandtheoverlappingupperjurassictolowercretaceousgravinasequence southeastalaska-caltechthesis | 2 | 0 % |
| thephysicsofhigh-velocityionsinthehallthrusternear-field-caltechthesis | 2 | 0 % |
| suspension instability | 2 | 0 % |
| malematingbehaviorincaenorhabditiselegans-caltechthesis | 2 | 0 % |
| characterization waveguide polymer cut back optical loss microring | 2 | 0 % |
| mossbauerdiffractometry principles practice andanapplicationtoastudyofchemicalorderin57fe3al-caltechthesis | 2 | 0 % |
| compressiblevorticesandshock-vortexinteractions-caltechthesis | 2 | 0 % |
| asurveyofresultsinmodernprecisioncosmology-caltechthesis | 2 | 0 % |
| bifurcationsinsingleatomcavityqed-caltechthesis | 2 | 0 % |
| calculationofthen 1238 electromagneticmassdifferencesbys-matrixmethods-caltechthesis | 2 | 0 % |
| 在标题 biological electron transfer | 2 | 0 % |
| ethanol production by saccharomyces cerevisiae immobilised in calcium alginate | 2 | 0 % |
| experimentsonthinairfoilsspanningatransonicshearflow-caltechthesis | 2 | 0 % |
| noelinsinneuraldevelopment-caltechthesis | 2 | 0 % |
| effect | 2 | 0 % |
| shock–vortex interactions | 2 | 0 % |
| itemswhereoptionis computerscience andyearis2004-caltechthesis | 2 | 0 % |
| i.experimentalobservationsofthemicrolayerinvaporbubblegrowthonaheatedsolid.ii.aninvestigationofthetheoryofevaporationandcondensation-caltechthesis | 2 | 0 % |
| power grid complex network university | 2 | 0 % |
| adaptiveanddiversitytechniquesforwirelessdigitalcommunicationsoverfadingchannels-caltechthesis | 2 | 0 % |
| itemswhereoptionis civilengineering andyearis1933-caltechthesis | 2 | 0 % |
| reactionsofanaluminumstabilizedtitaniumalkylidene-caltechthesis | 2 | 0 % |
| o2 reduction mechanism | 2 | 0 % |
| assignment problem theory | 2 | 0 % |
| theeffectofdiverecoveryflapsontheliftofatwodimensionalsymmetricalairfoilwithchangesinchordwiselocationoftheflaps-caltechthesis | 2 | 0 % |
| engineeringofproteinglycosylationinchinesehamsterovarycells-caltechthesis | 2 | 0 % |
| itemswhereoptionis biochemistryandmolecularbiophysics andyearis1995-caltechthesis | 2 | 0 % |
| spectroscopyandwavelengthconversionbyfour-wavemixinginsemiconductoropticalamplifers-caltechthesis | 2 | 0 % |
| spatialandspectralbehaviorofspeckleinanimagingsystem-caltechthesis | 2 | 0 % |
| applicationofdynamicalsystemstheorytononlinearaircraftdynamics-caltechthesis | 2 | 0 % |
| models of bottom-up nad top-down visual atteniion | 2 | 0 % |
| itemswhereoptionis physics andyearis1958-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-04 -main | 2 | 0 % |
| aphotoelectricstudyoflineintensitiesintheironarcspectrum-caltechthesis | 2 | 0 % |
| ultrasound irradiation | 2 | 0 % |
| martensiticphasetransitionswithsurfaceeffects-caltechthesis | 2 | 0 % |
| dhawan s direct measurements of skin friction pdf | 2 | 0 % |
| radiationofseismicsurface-wavesfromfinitemovingsources-caltechthesis | 2 | 0 % |
| ontheconcentrationofspacechargeinthevicinityofaninsulatingsurface-caltechthesis | 2 | 0 % |
| rollingmomentduetoyawofflatwingsoftrapezoidalplanformatsupersonicspeeds-caltechthesis | 2 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis1965-caltechthesis | 2 | 0 % |
| responseofauniformfree-pinnedbeamtolateralsinusoidalandrandomexcitation-caltechthesis | 2 | 0 % |
| i.predictingequilibriumstableisotopefractionationsofiron chlorine andchromium.ii.oxygen-isotopeinvestigationofmesozoicandcenozoicgranitoidsofthenortheasterngreatbasin nevadaandutah-caltechthesis | 2 | 0 % |
| low energy electron diffraction instrument | 2 | 0 % |
| transition metal catalytic decomposition of hydrogen peroxide | 2 | 0 % |
| preparation of a metallic glasses | 2 | 0 % |
| theroleofnet1phosphorylationinregulatingcdc14releaseduringmitoticexit-caltechthesis | 2 | 0 % |
| quantumwellintersubbandtransitions nonlinearoptics refractiveindexandinfraredmodulation-caltechthesis | 2 | 0 % |
| itemswhereoptionis appliedmechanics andyearis2002-caltechthesis | 2 | 0 % |
| chemicalreactionsataqueousinterfaces-caltechthesis | 2 | 0 % |
| investigationofthelithium-6 proton neutron beryllium-6reactionbytheneutronthresholdtechnique-caltechthesis | 2 | 0 % |
| new directions in sparse sampling and estimation for underdetermined systems | 2 | 0 % |
| holocene geomagnetic secular variation in the western united states implications for the global geomagnetic field | 2 | 0 % |
| Other phrases | 4670 | 60.3 % |