| 6032 different keyphrases | Search | Percent |
|---|
| browsebydegree/thesistype-caltechthesis | 51 | 0.6 % |
| browsebydegree-caltechthesis | 29 | 0.3 % |
| null | 22 | 0.2 % |
| browsebyeprintid-caltechthesis | 20 | 0.2 % |
| browsebycommitteemember-caltechthesis | 19 | 0.2 % |
| lithium ion battery l3-edge | 19 | 0.2 % |
| aurora borealis | 17 | 0.2 % |
| magnetic materials pdf | 17 | 0.2 % |
| browsebyauthor-caltechthesis | 17 | 0.2 % |
| acknowledgements thesis | 16 | 0.2 % |
| caltech uniform | 16 | 0.2 % |
| browsebyadvisor-caltechthesis | 15 | 0.1 % |
| caltech thesis | 15 | 0.1 % |
| dedication thesis | 13 | 0.1 % |
| reduction potential of visible light photocatalysis | 13 | 0.1 % |
| motor imagery sensorimotor representations mental practice skill learning task variability | 12 | 0.1 % |
| acknowledgement thesis | 11 | 0.1 % |
| time dependent failure of thin films | 10 | 0.1 % |
| officemate filetype pdf | 10 | 0.1 % |
| hot-wire chemical vapor deposition of silicon and silicon nitride for photovoltaics experiments simulations and applications california institute of technology | 9 | 0.1 % |
| lithium iron phosphate | 9 | 0.1 % |
| dedication for thesis | 9 | 0.1 % |
| sp1 gda | 9 | 0.1 % |
| models of bottom-up and top-down visual attention | 8 | 0.1 % |
| neurofinance | 8 | 0.1 % |
| fine grained multicomputer | 8 | 0.1 % |
| office mate filetype pdf | 8 | 0.1 % |
| silicon mems for fluidics | 8 | 0.1 % |
| studiesoflipid-lipidinteractionsinphospholipidbilayermembranes-caltechthesis | 8 | 0.1 % |
| acknowledgements | 8 | 0.1 % |
| http //thesis.library.caltech.edu/4242/ | 7 | 0 % |
| lifang adaptive | 7 | 0 % |
| localization microscopy camera -andor | 7 | 0 % |
| web | 7 | 0 % |
| duke island alaska | 7 | 0 % |
| earthquake in bago region | 7 | 0 % |
| trabuco formation | 7 | 0 % |
| tectonichistoryoftheosbournspreadingcenteranddynamicsubsidenceofthecongobasin-caltechthesis | 6 | 0 % |
| thesis.library.caltech.edu | 6 | 0 % |
| neal scruggs cal tech | 6 | 0 % |
| acknowledgement for phd thesis | 6 | 0 % |
| http //resolver.caltech.edu/caltechetd etd-09182007-093920 | 6 | 0 % |
| publications | 6 | 0 % |
| thesis tuning | 6 | 0 % |
| phd thesis acknowledgement | 6 | 0 % |
| thesis front matter | 6 | 0 % |
| betac | 6 | 0 % |
| aninvestigationofcollisionlessplasmabeaminteractionwithanonhomogeneousmagneticfield-caltechthesis | 5 | 0 % |
| advanced topology physics quantum | 5 | 0 % |
| distributedcontrolandcomputing optimalestimation error-correctingcodes andinteractiveprotocols-caltechthesis | 5 | 0 % |
| macroscopicpropertiesofelectricallyinteractingsuspensions-caltechthesis | 5 | 0 % |
| interactionsbetweentroposphericchemistryandaerosolsinaunifiedgcmsimulation-caltechthesis | 5 | 0 % |
| http //thesis.library.caltech.edu/8049/ | 5 | 0 % |
| using control for sensing and decision making | 5 | 0 % |
| electroninteractions afieldtheoreticgeneralizationofthegell-mann-bruecknertheoryandacalculationofexchangeeffects-caltechthesis | 5 | 0 % |
| thesis dedication | 5 | 0 % |
| acknowledgements dissertation | 5 | 0 % |
| neu thesis california institute 1978 | 5 | 0 % |
| ig superfamily | 5 | 0 % |
| neutrinomassimplicationsforphysicsbeyondthestandardmodel-caltechthesis | 5 | 0 % |
| nanowicking multi-scaleflowinteractionwithnanofabricstructures-caltechthesis | 5 | 0 % |
| i.globalsimulationsofinteractionsbetweenaerosolsandfutureclimateandii.sensitivityofmultiangleimagingtotheopticalandmicrophysicalpropertiesofbiomassburningaerosols-caltechthesis | 5 | 0 % |
| thesis acknowledgements | 5 | 0 % |
| black butte antelope valley geology | 5 | 0 % |
| siphon spillway | 5 | 0 % |
| aptamer challenges | 5 | 0 % |
| buckling of thin walled cylinders | 4 | 0 % |
| tecuya mammal fossils | 4 | 0 % |
| energy-delaycomplexityofasynchronouscircuits-caltechthesis | 4 | 0 % |
| electronic thesis table of contents for supplementary materials | 4 | 0 % |
| investigationofanecrplasmathrusterandplasmabeaminteractionswithamagneticnozzle-caltechthesis | 4 | 0 % |
| interactionofhydrogenwithnovelcarbonmaterials-caltechthesis | 4 | 0 % |
| run-upandnonlinearpropagationofoceanicinternalwavesandtheirinteractions-caltechthesis | 4 | 0 % |
| map of old elsinore gold mine good hope | 4 | 0 % |
| shape selective recognition of the dna minor groove by hairpin polyamides | 4 | 0 % |
| http //thesis.library.caltech.edu/4849/ | 4 | 0 % |
| clostridium pdf | 4 | 0 % |
| acknowledgement of thesis | 4 | 0 % |
| protein ligand interaction | 4 | 0 % |
| armoni string theory | 4 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1989-caltechthesis | 4 | 0 % |
| itemswhereoptionis geology andyearis1943-caltechthesis | 4 | 0 % |
| final chapter thesis | 4 | 0 % |
| thesis for a explicit and implicit picture | 4 | 0 % |
| photonic whispering-gallery resonators in new environments | 4 | 0 % |
| micros electret | 4 | 0 % |
| nurbs based otg | 4 | 0 % |
| analysisofinteractingnucleicacidsindilutesolutions-caltechthesis | 4 | 0 % |
| wnt signaling/ b-catenin | 4 | 0 % |
| sensitizer-linked substrates as probes of heme enzyme structure and catalysis | 4 | 0 % |
| stellar content of elliptical galaxies | 4 | 0 % |
| absolutelyirreduciblecurveswithapplicationstocombinatoricsandcodingtheory-caltechthesis | 4 | 0 % |
| unsteadyforcesonoscillatinghydrofoils-caltechthesis | 4 | 0 % |
| studiesofelectroweakinteractionsandsearchesfornewphysicsusingphotoniceventswithmissingenergyatthelargeelectron-positroncollider-caltechthesis | 4 | 0 % |
| paper electrophoresis pdf | 4 | 0 % |
| theinteractionofflowdiscontinuitieswithsmalldisturbancesinacompressiblefluid-caltechthesis | 4 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-11 -urlentry | 4 | 0 % |
| appendix in thesis | 4 | 0 % |
| content | 4 | 0 % |
| visualizingthemembraneconfinement traffickingandstructureofthegabatransporter gat1-caltechthesis | 4 | 0 % |
| electron resonance spectroscopic splitting factor | 4 | 0 % |
| images of a coherent thesis | 4 | 0 % |
| hadley clouds | 4 | 0 % |
| lithotripsy stone of kidney thesis pdf | 4 | 0 % |
| lightly doped si microwires operating under high-level injection conditions | 4 | 0 % |
| phaseconjugateoptics onthetheory observation andutilizationoftemporallly-reversedwavefrontsasgeneratedvianonlinearopticalparametricinteractions-caltechthesis | 4 | 0 % |
| extraction of gallium | 4 | 0 % |
| graphicalmodelsanditerativedecoding-caltechthesis | 4 | 0 % |
| modelling analysis and design of switching converters | 4 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-03 -main | 4 | 0 % |
| a sample thank you letter to my advisor for her support | 4 | 0 % |
| joshua tree geology | 4 | 0 % |
| geology of myanmar pdf | 4 | 0 % |
| thesis complete | 4 | 0 % |
| themultistrandsimulator stochasticsimulationofthekineticsofmultipleinteractingdnastrands-caltechthesis | 4 | 0 % |
| fabricationandtestingofnbn/mgo/nbntunneljunctionsforuseashigh-frequencyheterodynedetectors-caltechthesis | 4 | 0 % |
| dedication in thesis | 4 | 0 % |
| http //thesis.library.caltech.edu/2115/ | 4 | 0 % |
| itemswhereoptionis materialsscience andyearis2010-caltechthesis | 4 | 0 % |
| azotobacter | 4 | 0 % |
| fossils found near tonopah nv | 4 | 0 % |
| photocatalytic hydrogen production ph | 4 | 0 % |
| itemswhereoptionis engineeringandappliedscience andyearis1931-caltechthesis | 4 | 0 % |
| fe2o3 algae | 3 | 0 % |
| iterativedecodingandgraphicalcoderepresentations-caltechthesis | 3 | 0 % |
| lasingandmodifiedspontaneousemissioninphotoniccrystalstructuresandmicrocavities-caltechthesis | 3 | 0 % |
| torsional irregularity | 3 | 0 % |
| vitreous humor | 3 | 0 % |
| experimental study of unsteady hydrodynamic force matrices on whirling centrifugal pump impellers | 3 | 0 % |
| angleresolvedphotoemissioncalculations-caltechthesis | 3 | 0 % |
| chapter 2 thesis | 3 | 0 % |
| an investigation of the effects of earthquakes on buildings | 3 | 0 % |
| theinfiniterangeheisenbergmodelandhightemperaturesuperconductivity-caltechthesis | 3 | 0 % |
| mems tuning vcsel telaris | 3 | 0 % |
| strain softening definition | 3 | 0 % |
| aspecial-purposeelectricanalogcomputeranditsapplicationtothesolutionofcertainnonlineardifferentialequations-caltechthesis | 3 | 0 % |
| stress and thesis | 3 | 0 % |
| number of locust ors | 3 | 0 % |
| acknowledgment for thesis | 3 | 0 % |
| naturalconvectionfilmboilingonaverticalsurface-caltechthesis | 3 | 0 % |
| the tree machine | 3 | 0 % |
| sample of appendices in thesis | 3 | 0 % |
| astudyofthepolarizationofwaterandmethanolbyvariousdiamagneticionsinanaproticsolvent-caltechthesis | 3 | 0 % |
| enantioselective | 3 | 0 % |
| viscoelastic models maxwell kelvin channelized | 3 | 0 % |
| http //thesis.library.caltech.edu/7521/ | 3 | 0 % |
| ultrasonic irradiation | 3 | 0 % |
| naude on the mechanism of cavitation damage by | 3 | 0 % |
| whats the workload for an electrical engineering major at caltecc | 3 | 0 % |
| yg661 laser | 3 | 0 % |
| hydrogels pdf | 3 | 0 % |
| parallelhierarchicaln-bodymethods-caltechthesis | 3 | 0 % |
| http //thesis.library.caltech.edu/2648/ | 3 | 0 % |
| sensor networks for geospatial event detection--- theory and applications | 3 | 0 % |
| parasitism architecture | 3 | 0 % |
| studyofthestall-spinphenomenausinganalysisandinteractive3-dgraphics-caltechthesis | 3 | 0 % |
| simulationoftheflowpastanimpulsivelystartedcylinderusingadiscretevortexmethod-caltechthesis | 3 | 0 % |
| thesis vijay natraj | 3 | 0 % |
| bandwidth limitation filetype pdf | 3 | 0 % |
| hydrodynamicforcesinducedinfluidcontainersbyearthquakes-caltechthesis | 3 | 0 % |
| investigation of the turbulent mixing regions formed by jets | 3 | 0 % |
| appendices | 3 | 0 % |
| interactionsbetweenmoleculesandsuperconductors-caltechthesis | 3 | 0 % |
| keller box method | 3 | 0 % |
| detonationinteractionwithsharpanddiffuseinterfaces-caltechthesis | 3 | 0 % |
| list of figures in thesis | 3 | 0 % |
| neuronal crop | 3 | 0 % |
| sigrid barklund | 3 | 0 % |
| itemswhereoptionis civilengineering andyearis1991-caltechthesis | 3 | 0 % |
| i.seismologicalstudyoftheninetyeastandchagos-laccadiveridges indianocean.ii.modelsforasymmetricandobliquespreadingatmidoceanridges.iii.attenuationstudiesusingsplitnormalmodes.-caltechthesis | 3 | 0 % |
| phd acknowledgements | 3 | 0 % |
| semi-containedinteractionsofatmosphericneutrinosinthemacrodetector-caltechthesis | 3 | 0 % |
| mushalagan | 3 | 0 % |
| thesis introduction | 3 | 0 % |
| helical pressure | 3 | 0 % |
| characterizationofcloudwaterandprecipitationchemistryanddepositionatelevatedsitesincentralandsoutherncalifornia-caltechthesis | 3 | 0 % |
| i interannualvariabilityofstratosphericozoneandtemperature.ii seasonalcycleofn2o-caltechthesis | 3 | 0 % |
| itemswhereoptionis chemistry andyearis1981-caltechthesis | 3 | 0 % |
| drosophila and dispersal | 3 | 0 % |
| corneas mechanical properties | 3 | 0 % |
| shockwaveinteractioninhypervelocityflow-caltechthesis | 3 | 0 % |
| plantinum ammonia complex | 3 | 0 % |
| parti 3-phenylcyclobut-2-enoneand3-phenylcyclobutanonederivatives.partii calculationofthedelocalizationenergiesofsomesmall-ringsystemsemployingthesimplemolecularorbitaltreatment-caltechthesis | 3 | 0 % |
| theiterativeschwingervariationalmethodappliedtoelectron-moleculecontinuumprocesses-caltechthesis | 3 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1993-caltechthesis | 3 | 0 % |
| itemswhereoptionis socialscience andyearis2009-caltechthesis | 3 | 0 % |
| itemswhereoptionis civilengineering andyearis1975-caltechthesis | 3 | 0 % |
| vibrational frequency of urea | 3 | 0 % |
| arelativisticquarkmodelwithharmonicdynamics-caltechthesis | 3 | 0 % |
| gas-phaseterahertzspectroscopyandthestudyofcomplexinterstellarchemistry-caltechthesis | 3 | 0 % |
| http //thesis.library.caltech.edu/1871/2/1chapter_1.pdf | 3 | 0 % |
| theeffectofcurvatureonthetransitionfromlaminartotheturbulentboundarylayer-caltechthesis | 3 | 0 % |
| vertebrate glial cells | 3 | 0 % |
| anexperimentalinvestigationofheattransferfromfinewirestostillairatlowdensity-caltechthesis | 3 | 0 % |
| designanddevelopmentofnewenantioselectivecatalyticreactionsandprogresstowardsthetotalsynthesisofcallipeltosidea-caltechthesis | 3 | 0 % |
| thesis-carotenoids biosynthesis | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-05 -urlexit | 3 | 0 % |
| studiesinpanelflutterathighermachnumbers.i.flatandslightlycurvedpanelsatmachnumber2.81.ii.cylindricalshellswithboundarylayer-caltechthesis | 3 | 0 % |
| thedynamicsofcondensationandvaporization-caltechthesis | 3 | 0 % |
| itemswhereoptionis astronomy andyearis1997-caltechthesis | 3 | 0 % |
| onp-adicestimatesofweightsinabeliancodesovergaloisrings-caltechthesis | 3 | 0 % |
| thesis for carbonic anhydrase | 3 | 0 % |
| thelongitudinalstabilityofaflying-boatintheplaningconditionascomputedfromtanktestdataofahullmodel-caltechthesis | 3 | 0 % |
| debaleena nandi | 3 | 0 % |
| thesis cells solar gratzel | 3 | 0 % |
| caltech p11 | 3 | 0 % |
| ultra-high-q | 3 | 0 % |
| theoryoflaminarviscous-inviscidinteractionsinsupersonicflow-caltechthesis | 3 | 0 % |
| determinationofmultiquantumvibrationaltransitionmomentsinhydrogeniodideandtheirsignificanceinitsvibrationalphotochemistry.-caltechthesis | 3 | 0 % |
| biosensors pdf | 3 | 0 % |
| formation constant of mercury ii chloride | 3 | 0 % |
| someexperimentalstudiesoflaminarburningvelocity-caltechthesis | 3 | 0 % |
| holocene stratigraphy and chronology of mountain meadows sierra nevada california | 3 | 0 % |
| anexperimentalinvestigationofstructure mixingandcombustionincompressibleturbulentshearlayers-caltechthesis | 3 | 0 % |
| consequences of cosmic dust | 3 | 0 % |
| aninkrecordingoscillographforsteadystatea.c.phenomenaintheaudiorange-caltechthesis | 3 | 0 % |
| graph-basedcodesanditerativedecoding-caltechthesis | 3 | 0 % |
| astudyofhydrodynamicinteractionsofmacromoleculesinsolutionsbymeansofprecisionviscometry-caltechthesis | 3 | 0 % |
| lifeinextremeenvironments lanthanide-baseddetectionofbacterialsporesandothersensordesignpursuits-caltechthesis | 3 | 0 % |
| time dependent failure thin films | 3 | 0 % |
| what limitations are there on gerrymandering | 3 | 0 % |
| http //thesis.library.caltech.edu/5183/ | 3 | 0 % |
| metal glass plasticity optical microstructure | 3 | 0 % |
| practical compressed sensing modern data acquisition and signal processing | 3 | 0 % |
| cloudcomputingforcitizenscience-caltechthesis | 3 | 0 % |
| bianchitypeicosmologicalmodels-caltechthesis | 3 | 0 % |
| interactionlawforacollisionbetweentwosolidparticlesinaviscousliquid-caltechthesis | 3 | 0 % |
| etd @ caltech | 3 | 0 % |
| robustcontrolsystemdesignforafixed-bedcatalyticreactor-caltechthesis | 3 | 0 % |
| heat of vapourization of 1-hexene | 3 | 0 % |
| mathematical microfluidic passive pumping | 3 | 0 % |
| partyandconstituencyinvictorianbritain-caltechthesis | 3 | 0 % |
| sourcecontributionstothesizeandcompositiondistributionofurbanparticulateairpollution-caltechthesis | 3 | 0 % |
| preliminary pages | 3 | 0 % |
| dualpolarizedandbalancedreceiversatmillimeterandsubmillimeterwavelengths-caltechthesis | 3 | 0 % |
| iterativedecodingandpseudo-codewords-caltechthesis | 3 | 0 % |
| thesis front page | 3 | 0 % |
| thesis acknowledgement sample | 3 | 0 % |
| sliding mode control of three switching power converters | 3 | 0 % |
| valveless pump | 3 | 0 % |
| jin-yoo suh bmg bonding | 3 | 0 % |
| hypersonicviscous-inviscidflowinteractionsincludingboundarylayerseparationonaflatplateatangleofattack-caltechthesis | 3 | 0 % |
| analysis and state space modeling of cuk converter | 3 | 0 % |
| analysis of the resolution between ambiguous velocity and re铿俥ctor position for traveltime tomography | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2007-09 -unknownos | 3 | 0 % |
| mpc control | 3 | 0 % |
| dr. thomas grettenberg caltech | 3 | 0 % |
| jean-fran莽ois marin caltech | 3 | 0 % |
| itemswhereoptionis biology andyearis1961-caltechthesis | 3 | 0 % |
| thermal properties of nanomaterials | 3 | 0 % |
| calibration of piston puppets | 3 | 0 % |
| inorganiccomponentsofatmosphericaerosols-caltechthesis | 3 | 0 % |
| riboswitch response curve | 3 | 0 % |
| statisticsforthesis.library.caltech.edu 2008-08 -errors404 | 3 | 0 % |
| itemswhereyearis2001-caltechthesis | 3 | 0 % |
| conclusion of superconductors | 3 | 0 % |
| theinteractionofbreakingsolitarywaveswithanarmoredbed-caltechthesis | 3 | 0 % |
| cavitationinceptioninseparatedflows-caltechthesis | 3 | 0 % |
| effect of solute atoms on fermi surface in a solid solution | 3 | 0 % |
| theory of tunneling spectroscopy in unconventional superconductors thece phd | 3 | 0 % |
| optomechanical lasing | 3 | 0 % |
| particlemotionincolloidaldispersions applicationstomicrorheologyandnonequilibriumdepletioninteractions-caltechthesis | 3 | 0 % |
| studiesofamphibolitesandconstituenthornblendesfromanareaofprogressivemetamorphismnearlead southdakota-caltechthesis | 3 | 0 % |
| http //thesis.library.caltech.edu/487/ | 3 | 0 % |
| 71578 | 3 | 0 % |
| populationdynamicsinthepresenceofquasispecieseffectsandchangingenvironments-caltechthesis | 3 | 0 % |
| athresholdgatefeed-forwardswitchingnetalgorithm-caltechthesis | 3 | 0 % |
| thesis dedication quote | 3 | 0 % |
| design uncertainties | 3 | 0 % |
| i.theconsequencesofsystematicerrorinenzymekinetics.ii.l-tyrosyl-l-tyrosinederivativesforthedetectionoftranspeptidationinalpha-chymotrypsin-catalyzedhydrolyses.iii.theinteractionofalpha-methyl-alpha-acylaminoacidswithalpha-chymotrypsin.iv.theapparentionizationconstantsofaseriesofphenylalaninederivatives-caltechthesis | 3 | 0 % |
| joel burdick | 3 | 0 % |
| pacoima dam | 3 | 0 % |
| metallic glass | 3 | 0 % |
| http //thesis.library.caltech.edu/6077/ | 3 | 0 % |
| onthemechanismofcavitationdamagebynon-hemisphericalcavitiescollapsingincontactwithasolidboundary-caltechthesis | 3 | 0 % |
| thehelix-coiltransitionindna effectsoftheinteractionswithsmallionsandofthecompositionofdna-caltechthesis | 3 | 0 % |
| shapechangingtransformations interactionswithplasticityandelectrochemicalprocesses-caltechthesis | 3 | 0 % |
| higgsscalarsandthenonleptonicweakinteractions-caltechthesis | 3 | 0 % |
| anisotropiesandinteractionsinshearflowofmacromolecularsuspensions-caltechthesis | 3 | 0 % |
| sodiumbyelectrolysisthroughglass-caltechthesis | 3 | 0 % |
| lake powell wildman | 3 | 0 % |
| itemswhereoptionis astronomy andyearis1952-caltechthesis | 3 | 0 % |
| coherent thesis | 3 | 0 % |
| acoustic nonlinearity parameter for propellants | 3 | 0 % |
| astudyofalaterallyloadedthincircularcylindricalshell-caltechthesis | 3 | 0 % |
| impedance pump | 3 | 0 % |
| http //resolver.caltech.edu/caltechthesis 05222013-080427740 | 3 | 0 % |
| computational enzyme design | 3 | 0 % |
| from ordinal ranking to binary classi铿乧ation | 3 | 0 % |
| limitsoncomputationallyefficientvcg-basedmechanismsforcombinatorialauctionsandpublicprojects-caltechthesis | 3 | 0 % |
| homepage | 3 | 0 % |
| responseofauniformfree-pinnedbeamtolateralsinusoidalandrandomexcitation-caltechthesis | 3 | 0 % |
| gel permeation chromatography | 3 | 0 % |
| i.applicationofnormalmodetheorytoseismicsourceandstructureproblems.ii.seismicinvestigationsofuppermantlelateralheterogeneity.-caltechthesis | 3 | 0 % |
| 3 degree radical organic | 3 | 0 % |
| quantitativecharacterizationof3ddeformationsofcellinteractionswithsoftbiomaterials-caltechthesis | 3 | 0 % |
| shockwaves numerical simulation | 3 | 0 % |
| flying-hot-wire study of flow past an naca 4412 airfoil at maximum lift | 2 | 0 % |
| analysisofresonantconverters-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2011-01 -main | 2 | 0 % |
| ice growth on mars | 2 | 0 % |
| react mechanism for nitrogen monoxide and ozone | 2 | 0 % |
| plasticityinthecatvisualsystem-caltechthesis | 2 | 0 % |
| coupled-inductorinversion rectificationandcycloconversion-caltechthesis | 2 | 0 % |
| poly ic autism mice intesitne | 2 | 0 % |
| theinversionofgeodeticdataforearthquakeparameters-caltechthesis | 2 | 0 % |
| thetransmutationofelements-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/2971/ | 2 | 0 % |
| eigenvalueproblemsforpositivemonotonicnonlinearoperators-caltechthesis | 2 | 0 % |
| thereactionof3-arylpropylamineswithnitricacid-caltechthesis | 2 | 0 % |
| ted hubbard | 2 | 0 % |
| sourcesofmiocenesedimentsinsouthwesternsanjoaquinvalley-caltechthesis | 2 | 0 % |
| itemswhereoptionis bioengineering andyearis2011-caltechthesis | 2 | 0 % |
| norlaudanosoline production | 2 | 0 % |
| anexperimentalstudyoftheseparatedflowfieldaboutslenderdeltawingsoftriangularcrosssection-caltechthesis | 2 | 0 % |
| airfoil superfluid | 2 | 0 % |
| heating rate nucleation amorphous | 2 | 0 % |
| coupled inductor | 2 | 0 % |
| neural network algorithm pdf | 2 | 0 % |
| ahmed elbanna | 2 | 0 % |
| geochemical dispersion in deep sea | 2 | 0 % |
| vasquez canyon anticline california | 2 | 0 % |
| i.thermalandphotosensitizeddimerizationsof1 3-cyclohexadiene.ii.photosensitizedisomerizationofthestilbenes furtherstudies-caltechthesis | 2 | 0 % |
| evan grim | 2 | 0 % |
| development of the acyl acylation of arynes | 2 | 0 % |
| problems in analysis control and design of switching inverters and rectifiers | 2 | 0 % |
| effect of wall curvature on laminar to turbulent | 2 | 0 % |
| dynamicsofplasmastructuresinteractingwithexternalandself-generatedmagneticfields-caltechthesis | 2 | 0 % |
| alex nisthal | 2 | 0 % |
| viscosity amino acid solution | 2 | 0 % |
| densin-180 seizure | 2 | 0 % |
| caltech phd thesis oscillator caughey noise | 2 | 0 % |
| synthesisandcharacterizationofbulkmetallicglassmatrixcomposities-caltechthesis | 2 | 0 % |
| sentaurus dual junction convergence | 2 | 0 % |
| http //thesis.library.caltech.edu/2787/1/naude_cf_1960.pdf | 2 | 0 % |
| analysisofaninteractivevideoarchitecture-caltechthesis | 2 | 0 % |
| dspace @ caltech | 2 | 0 % |
| rupturephenomenainviscoelasticmaterials-caltechthesis | 2 | 0 % |
| universalbiosignaturesforthedetectionoflife-caltechthesis | 2 | 0 % |
| nmr li licopo4 | 2 | 0 % |
| itemswhereoptionis appliedmechanics andyearis1993-caltechthesis | 2 | 0 % |
| solar rf radiation | 2 | 0 % |
| instablities of suspension | 2 | 0 % |
| scanning tunneling spectroscopy cuprat | 2 | 0 % |
| 3 soret band values of cytochrome c | 2 | 0 % |
| ultrahighfrequencyoscillators-caltechthesis | 2 | 0 % |
| theeffectofconfigurationinteractiononintensityanomalies-caltechthesis | 2 | 0 % |
| fe3 reduction by pseudomonas | 2 | 0 % |
| analysis of rectifier circuits | 2 | 0 % |
| earthquake excitation definition | 2 | 0 % |
| phase field modeling of martensitic phase transition dissertation | 2 | 0 % |
| thermalplumesfromstagedmultiportdiffusersinuniformquiescentenvironment-caltechthesis | 2 | 0 % |
| haojiang zhou caltech | 2 | 0 % |
| triplet anthranthrone | 2 | 0 % |
| i.thegeneralizedvalencebonddescriptionofo_2ii.configurationinteractionstudiesonlow-lyingstatesofo_2-caltechthesis | 2 | 0 % |
| itemswhereoptionis physics andyearis1943-caltechthesis | 2 | 0 % |
| socialinteractionsandgiving-caltechthesis | 2 | 0 % |
| galcit | 2 | 0 % |
| higherorderapproximationsfortransonicflowoverslenderbodies-caltechthesis | 2 | 0 % |
| astudyofhorizontalcell-photoreceptorinteractioninthefrogretinausingarandomlymodulatedstimulus-caltechthesis | 2 | 0 % |
| sediment laden flows | 2 | 0 % |
| chebyshev spectral method | 2 | 0 % |
| interactionmeasuresforsystemsunderdecentralizedcontrol-caltechthesis | 2 | 0 % |
| theoreticalstudiesofchemisorptionprocessesonnickelsurfaces-caltechthesis | 2 | 0 % |
| molecularexpressionsystemdesign theoreticalandexperimentalcharacterizationofanovelcross-regulationsystemanditsapplicationasametabolicswitch-caltechthesis | 2 | 0 % |
| interactiveseismicimagingonamulticomputerandapplicationtothehosgrifault-caltechthesis | 2 | 0 % |
| caltech boundary layer combustion | 2 | 0 % |
| edgetonesandacousticresonancesinaduct-caltechthesis | 2 | 0 % |
| nmrstudiesofprotein-dnainteractions determinationsofdnastructuresrecognizedbybinrecombinaseandstudiesoftheirrolesinproteinbindinginteractions-caltechthesis | 2 | 0 % |
| repeatedloadsabovetheproportionallimiton24staluminumalloy-caltechthesis | 2 | 0 % |
| on the importance of polarisation in radar scattering systems | 2 | 0 % |
| http //thesis.library.caltech.edu/1685/7/06chapter6-part_ii-vo2.pdf | 2 | 0 % |
| thesis reference | 2 | 0 % |
| dnabindingpolyamidesinbiologicalsystems-caltechthesis | 2 | 0 % |
| thedistributionofrichclustersofgalaxies-caltechthesis | 2 | 0 % |
| vector and tensor analysis harry lass pdf | 2 | 0 % |
| wood holocene stratigraphy and chronology of mountain meadows | 2 | 0 % |
| logarithmic spiral fluid millikan | 2 | 0 % |
| studyofmagmasources mantlestructureandthedifferentiationoftheearthfromvariationsof¹⁴³nd/¹⁴⁴ndinigneousrocks-caltechthesis | 2 | 0 % |
| applicationoftwo-dimensionalfinite-differencewavesimulationtoearthquakes earthstructure andseismichazard-caltechthesis | 2 | 0 % |
| engineeringprotein-basedbiomaterialswithbiologicalandmechanicalcuestodirectcellularbehavior-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-11 -unknownos | 2 | 0 % |
| solid acid fuel cell | 2 | 0 % |
| preskill cortese | 2 | 0 % |
| x-raydiffractionstudiesofdensefluids-caltechthesis | 2 | 0 % |
| itemswhereoptionis bioengineering andyearis2005-caltechthesis | 2 | 0 % |
| doubly-taggeddsdecaysat4.03gev-caltechthesis | 2 | 0 % |
| determinationoftheinteractionpotentialofthenoblegasesfromshockwavestructureexperiments.feasibilityofamodifiedelectronbeamdensitometertechniquetomeasurediffusiveseparationinshockwavesinhelium-argonmixtures-caltechthesis | 2 | 0 % |
| ultracentrifugestudiesondeoxyribonucleicacidandtobaccomosaicvirus.i.theeffectofangularvelocityonthesedimentationvelocitybehaviorofdnaandtmv.ii.thethreecomponenttheoryofsedimentationequilibriuminadensitygradientandthehydrationofdna.iii.theeffectsofpressureonthebuoyantbehaviorofdnaandtmvinadensitygradientatequilibrium-caltechthesis | 2 | 0 % |
| extreme participation product aggregation dustin | 2 | 0 % |
| quantummechanicsoftheinteractionofgravitywithelectrons theoryofaspin-twofieldcoupledtoenergy-caltechthesis | 2 | 0 % |
| thekineticsofthealpha-chymotrypsincatalyzedhydrolysisofacetyl-l-hexahydrophenylalaninamide.theinfluenceofphonthekineticconstantsforalpha-chymotrypsincatalyzedreactioninvolvingselectedsubstratesandinhibitors.geneticstudiesinneurosporacrassa-caltechthesis | 2 | 0 % |
| rg-flows ads/cftcorrespondenceandstabilityofnon-dilatonicbranes-caltechthesis | 2 | 0 % |
| jawbone canyon | 2 | 0 % |
| rheologicalbehaviorofcolloidalsuspensions theeffectsofhydrodynamicinteractions-caltechthesis | 2 | 0 % |
| laufer investigaton of tubulent flow | 2 | 0 % |
| measurementsofmagneticfieldfluctuationsinthecaltechresearchtokamak-caltechthesis | 2 | 0 % |
| geologyoftheanorthositemassifinchestercounty pennsylvania-caltechthesis | 2 | 0 % |
| pressure loaded plate | 2 | 0 % |
| theoxygen-16 oxygen-16reaction-caltechthesis | 2 | 0 % |
| pnp chemistry | 2 | 0 % |
| thesis on nanophotonics | 2 | 0 % |
| asghar aryanfar | 2 | 0 % |
| hydrogen storage materials | 2 | 0 % |
| one centimeter | 2 | 0 % |
| social navigation in crowds pineau | 2 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis2002-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-02 -refererse | 2 | 0 % |
| ion engine erosion | 2 | 0 % |
| talc geology | 2 | 0 % |
| biaxial straining flow | 2 | 0 % |
| neural networks algorithms | 2 | 0 % |
| drhc with delay | 2 | 0 % |
| lineprofilesinnuclearmagneticresonanceabsorption-caltechthesis | 2 | 0 % |
| force-detectednuclearmagneticresonanceindependentoffieldgradients-caltechthesis | 2 | 0 % |
| molecularbeaminvestigationsofsurfacechemicalreactionsanddynamics-caltechthesis | 2 | 0 % |
| geologic maps of the santa monica mountains | 2 | 0 % |
| atmosphericdynamicsinamodelrrlyraestar-caltechthesis | 2 | 0 % |
| top down attention | 2 | 0 % |
| one-dimensionalphysicsofinteractingelectronsandphononsincarbonnanotubes-caltechthesis | 2 | 0 % |
| acousto-optic signal processing | 2 | 0 % |
| plasma beam loop | 2 | 0 % |
| norris j.c. an analysis of a compound pendulum rocket suspension | 2 | 0 % |
| itemswhereoptionis electricalengineering andyearis1974-caltechthesis | 2 | 0 % |
| dynamical system identification system identification techniques | 2 | 0 % |
| isomerisation of chelate rings in organometallic chemistry | 2 | 0 % |
| anobject-orientedreal-timesimulationofmusicperformanceusinginteractivecontrol-caltechthesis | 2 | 0 % |
| identificationandcharacterizationofanegativeregulatorrequiredforspatialcontroloftheterritory-specificcyiiiageneintheseaurchinembryo-caltechthesis | 2 | 0 % |
| thesynthesisandcharacterizationofinorganicredoxreagent-modifiedcytochromesc-caltechthesis | 2 | 0 % |
| itemswhereoptionis chemicalengineering andyearis1974-caltechthesis | 2 | 0 % |
| photothermal effect | 2 | 0 % |
| cis-regulatoryanalysisofthekeydevelopmentalgene sox10 inneuralcrestandear-caltechthesis | 2 | 0 % |
| extraction of gallium from it ore | 2 | 0 % |
| itemswhereoptionis chemicalengineering andyearis2009-caltechthesis | 2 | 0 % |
| abriefstudyofthegeologyandgroundwaterconditionsinthepaumavalleyarea sandiegocounty california-caltechthesis | 2 | 0 % |
| anexperimentalinvestigationofhypersonicstagnationtemperatureprobes-caltechthesis | 2 | 0 % |
| charged droplet instability on a surface | 2 | 0 % |
| itemswhereoptionis geologicalandplanetarysciences andyearis1967-caltechthesis | 2 | 0 % |
| ojo caliente geology | 2 | 0 % |
| itemswhereoptionis computerscience andyearis1995-caltechthesis | 2 | 0 % |
| automatedanalysisofthedigitizedsecondpalomarskysurvey systemdesign implementation andinitialresults-caltechthesis | 2 | 0 % |
| photoprocessesinmetalcontainingmolecules-caltechthesis | 2 | 0 % |
| exploding wires | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis1964-caltechthesis | 2 | 0 % |
| depositedloopscouplingmagneticfilmsasfastcomputerelements-caltechthesis | 2 | 0 % |
| free gas diffusivity mixtures | 2 | 0 % |
| organocatalytic friedel-crafts | 2 | 0 % |
| hormoneandgenefeedbackduringdevelopmentandregenerationinarabidopsisthaliana-caltechthesis | 2 | 0 % |
| alargedeformationanalysisofplatesormembranesforthedeterminationofyoung smodulusandpoisson sratio-caltechthesis | 2 | 0 % |
| knudsen diffusion | 2 | 0 % |
| brett doleman phd | 2 | 0 % |
| hemoglobin signal-sequence | 2 | 0 % |
| two dimensional channel flow turbulence | 2 | 0 % |
| triostin dissertation | 2 | 0 % |
| radar performance bound mutual information | 2 | 0 % |
| caltech laser microdissection | 2 | 0 % |
| kinetics of a redox reaction-concentration effects | 2 | 0 % |
| geology san jose hills | 2 | 0 % |
| magneticfieldsandsupergranulevelocityfieldsonthequietsun-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-10 -main | 2 | 0 % |
| 17.63and18.14mevstatesinbe8-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/4991/ | 2 | 0 % |
| zerosofrandomorthogonalpolynomialsontheunitcircle-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-02 -urlexit | 2 | 0 % |
| thedistributionofbuoyantdensityofhumanerythrocytisinbovinealbuminsolutions-caltechthesis | 2 | 0 % |
| the effect of axisymmetric imperfections on the buckling of cylindrical shells under axial compression | 2 | 0 % |
| acontrolsystemforpositioningrecordingelectrodestoisolateneuronsinextracellularrecordings-caltechthesis | 2 | 0 % |
| designandchemicalsynthesisofsequencespecificdnacleavingmetalloproteins-caltechthesis | 2 | 0 % |
| chemical composition of vitreous humor | 2 | 0 % |
| analysesofhydrodynamicforcesoncentrifugalpumpimpellers-caltechthesis | 2 | 0 % |
| application for ground waves | 2 | 0 % |
| semiconductor photocatalysis | 2 | 0 % |
| ionic strength rate constant for malachite green and hydroxide | 2 | 0 % |
| california institute of technology library thesis | 2 | 0 % |
| tehachapi geology | 2 | 0 % |
| sequence-specificminorgroovebindingpolyamides dnarecognitionandapplications-caltechthesis | 2 | 0 % |
| theabundanceandbehaviorofvirusesinancientseawaterandmoderniron-richenvironments-caltechthesis | 2 | 0 % |
| districtingprinciplesanddemocraticrepresentation-caltechthesis | 2 | 0 % |
| labelling experiments for fenchone | 2 | 0 % |
| proteinfoldingandmacromoleculardynamics fundamentallimitsoflengthandtimescales-caltechthesis | 2 | 0 % |
| ouyang xiaoxi optics | 2 | 0 % |
| flexible mems skin technology for distributed fluidic sensing | 2 | 0 % |
| slobodan cuk | 2 | 0 % |
| chemical-scalemanipulationofionchannels invivononsensesuppressionandtargeteddisulfidecrosslinking-caltechthesis | 2 | 0 % |
| notch cis inhibition | 2 | 0 % |
| itemswhereoptionis geochemistry andyearis1986-caltechthesis | 2 | 0 % |
| experimentalstudiesofconversioncoefficientsinsomedeformednuclei-caltechthesis | 2 | 0 % |
| geologyofaportionoftheravennaquadrangle losangelescounty-caltechthesis | 2 | 0 % |
| fcc model iv | 2 | 0 % |
| r. b. vogelaar thesis | 2 | 0 % |
| phd thesis on organocatalysed friedel crafts alkylation | 2 | 0 % |
| fluidic self assembly | 2 | 0 % |
| ultrafast electron diffraction | 2 | 0 % |
| themeasurementofnucleargyromagneticratiosofshortlivedstatesusinginternalfields-caltechthesis | 2 | 0 % |
| error-correctioncodingindatastoragesystems-caltechthesis | 2 | 0 % |
| itti 2000 | 2 | 0 % |
| impactorsforaerosolmeasurement developmentsandsamplingbiases-caltechthesis | 2 | 0 % |
| caltech protein degradation | 2 | 0 % |
| stiffened suspension bridge | 2 | 0 % |
| christopher sungwook chang | 2 | 0 % |
| thin-film silicon photovoltaics characterization of thin-film deposition and analysis of enhanced light trapping from scattering nanoparticle arrays | 2 | 0 % |
| localization of light in photonic crystal | 2 | 0 % |
| stress matrix example | 2 | 0 % |
| jason rolfe | 2 | 0 % |
| how to calcu;ate autogyro roter blade | 2 | 0 % |
| ketyl radical resonance | 2 | 0 % |
| proportional cloud chamber | 2 | 0 % |
| theeffectsofcurvatureonturbulentmixinglayers-caltechthesis | 2 | 0 % |
| thesis format | 2 | 0 % |
| reaction of esters with phenylhydrazides of alpha-amino acids | 2 | 0 % |
| geologyofthesouthernsantaanamountains orangecounty california-caltechthesis | 2 | 0 % |
| thepassagetowardstallofnonslenderdeltawingsatlowreynoldsnumber-caltechthesis | 2 | 0 % |
| constrainedsequentiallamination nonconvexoptimizationandmaterialmicrostructure-caltechthesis | 2 | 0 % |
| turbulence and animals mix | 2 | 0 % |
| abstract thesis example | 2 | 0 % |
| beta-ray spectra | 2 | 0 % |
| virendra sarohia | 2 | 0 % |
| quantum mechanics montecarlo | 2 | 0 % |
| papers on centrifugal pump thesis dissertation | 2 | 0 % |
| neural logic | 2 | 0 % |
| open ended thesis | 2 | 0 % |
| circlepatterns main.cppfilereference | 2 | 0 % |
| ananalogvlsimotionsensorbasedontheflyvisualsystem-caltechthesis | 2 | 0 % |
| collisional dynamics of macroscopic particles in a viscous uid. | 2 | 0 % |
| ozoneandsecondaryorganicaerosolformationfromorganicprecursors-caltechthesis | 2 | 0 % |
| http //resolver.caltech.edu/caltechthesis 11192013-181748112 | 2 | 0 % |
| synthesis and rate of acetolysis of l-鈥媌icyclo[2.2.1]鈥媓eptylmethyl tosylate | 2 | 0 % |
| san bernadino tectonics | 2 | 0 % |
| economics dissertation | 2 | 0 % |
| reed scharff | 2 | 0 % |
| aunifiedframeworkforconstraint-basedmodeling-caltechthesis | 2 | 0 % |
| good acknowledgement thesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2008-04 -allrobots | 2 | 0 % |
| monotonicityandconnectednessinlearningsystems-caltechthesis | 2 | 0 % |
| thesis library | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-01 -unknownbrowser | 2 | 0 % |
| formation of the olfactory system embryologically | 2 | 0 % |
| natsiavas panagiotis | 2 | 0 % |
| map of whittier 1930 | 2 | 0 % |
| defectchemistryandprotonconductivityinba-basedperovskites-caltechthesis | 2 | 0 % |
| itemswhereoptionis chemicalengineering andyearis1955-caltechthesis | 2 | 0 % |
| a theoretical and experimental investigation of auctions in multi-unit demand environments | 2 | 0 % |
| interactionofweakshockwavesanddiscretegasinhomogeneities-caltechthesis | 2 | 0 % |
| mems technology and devices for a microfluid dosing system | 2 | 0 % |
| wei-hsun caltech | 2 | 0 % |
| akram boukai | 2 | 0 % |
| subduction veracruz | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2011-05 -urlentry | 2 | 0 % |
| an engineered glutamate-gated chloride glucl channel for sensitive consistent neuronal silencing by ivermectin | 2 | 0 % |
| keern canyon fault thesis | 2 | 0 % |
| rotatingflowsinacousticallyunstablerocketmotors-caltechthesis | 2 | 0 % |
| these phd tunneling spectroscopy in unconventional superconductors | 2 | 0 % |
| photocatalyst thesis | 2 | 0 % |
| tip clearance and tip vortex cavitation in an axial flow pump | 2 | 0 % |
| sequencecompositionandmismatcheffectsontriplehelixformation-caltechthesis | 2 | 0 % |
| 锝冿絹锝 锝旓絽锝冿綀 锝勶綁锝擄綋锝咃綊锝旓絹锝旓綁锝忥綆 锛掞紣锛戯紦 | 2 | 0 % |
| anme archaea | 2 | 0 % |
| vorticity boundary conditions at the walls | 2 | 0 % |
| solar stirling engine | 2 | 0 % |
| peptidylacylatingagentsinthepupaeofdrosophilamelanogasterandtheirpossiblerelationshiptoproteinsynthesis-caltechthesis | 2 | 0 % |
| thelargescalestructureoftheuniverse-caltechthesis | 2 | 0 % |
| synthesis of pyridine | 2 | 0 % |
| raytracingincomplexthree-dimensionalearthmodels-caltechthesis | 2 | 0 % |
| unsteady hydrodynamic force | 2 | 0 % |
| marion thomas avouac | 2 | 0 % |
| a geometric framework for dynamic vision | 2 | 0 % |
| highair-efficiencyinsulation-caltechthesis | 2 | 0 % |
| rotating rayleigh benard convection | 2 | 0 % |
| i.cedar--anapproachtothecomputerautomationofshort-periodlocalseismicnetworks.ii.seismotectonicsoftheimperialvalleyofsoutherncalifornia-caltechthesis | 2 | 0 % |
| i.interactionsoffastandslowwavesinproblemswithtwotimescales.ii.anumericalexperimentonthestructureoftwo-dimensionalturbulentflow-caltechthesis | 2 | 0 % |
| impactvolatilizationofcalciteandanhydriteandtheeffectonglobalclimatefromk/timpactcrateratchicxulub-caltechthesis | 2 | 0 % |
| spontaneousbreakdownofconformalandchiralinvariance-caltechthesis | 2 | 0 % |
| orr mechanism | 2 | 0 % |
| n o-bis trimethylsilyl acetamide in synthesis | 2 | 0 % |
| thermomechanicalvariationalprinciplesfordissipativematerialswithapplicationtostrainlocalizationinbulkmetallicglasses-caltechthesis | 2 | 0 % |
| studiesontheaminoacidmetabolismofhigherplants-caltechthesis | 2 | 0 % |
| chamberinvestigationsofsecondaryorganicaerosolformation-caltechthesis | 2 | 0 % |
| periodicvariationsofthegravitationalforce.agravitysurveyinthemonkhillarea.transmissionofshotimpulsesinshallowwater.-caltechthesis | 2 | 0 % |
| anexperimentalstudyofacousticallyexcited vortexdriven combustioninstabilitywithinarearwardfacingstepcombustor-caltechthesis | 2 | 0 % |
| hydrogenasesandhydrogensensorsinthesymbioticmicrobialcommunitiesofwood-feedingtermites-caltechthesis | 2 | 0 % |
| detonationstabilitywithreversiblekinetics-caltechthesis | 2 | 0 % |
| itemswhereoptionis electricalengineering andyearis2008-caltechthesis | 2 | 0 % |
| elizabeth wilcut connolly | 2 | 0 % |
| map of santa ana mountains | 2 | 0 % |
| a high speed tunable optical filter using the vernier effect with electro-optic polymer sampled bragg gratings and fiber fabry-perot | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-10 -urlexit | 2 | 0 % |
| astudyoftheperiodicandquasi-periodicsolutionsofthediscreteduffingequation-caltechthesis | 2 | 0 % |
| capacity au49ag5.5pd2.3cu26.9si16.3 | 2 | 0 % |
| spinningsymmetricmissilesinanonlinearaerodynamicfield-caltechthesis | 2 | 0 % |
| kirchhoff integral | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-07 -main | 2 | 0 % |
| computationalmethodsforstochasticbiologicalsystems-caltechthesis | 2 | 0 % |
| differential | 2 | 0 % |
| flatness underdetermined ordinary differential equation | 2 | 0 % |
| themolalreductionpotentialofseleniumandthefreeenergyofseleniousacidsfromequilibriummeasurements-caltechthesis | 2 | 0 % |
| modelreductionandminimalityforuncertainsystems-caltechthesis | 2 | 0 % |
| electromagnetic wave reflection from chiral media | 2 | 0 % |
| temperature gated channel md simulations | 2 | 0 % |
| influence of structural features on zeolite characterization by constraint index testing part two chapter | 2 | 0 % |
| glacial deposits in pdf | 2 | 0 % |
| permutationdecompositionof 0 1 -matricesanddecompositiontransversals-caltechthesis | 2 | 0 % |
| ignitionandcombustioninalaminarmixingzone-caltechthesis | 2 | 0 % |
| anarchitecturalviewofgametheoreticcontrol-caltechthesis | 2 | 0 % |
| processingofinternalleveldifferencesintheauditorybrainstemofthebarnowl-caltechthesis | 2 | 0 % |
| inelasticinteractionsinthedynamicresponseofstructures-caltechthesis | 2 | 0 % |
| brian sisk | 2 | 0 % |
| itemswhereyearis1940-caltechthesis | 2 | 0 % |
| sample acknowledgement for phd thesis | 2 | 0 % |
| miniature thesis | 2 | 0 % |
| multiplesteadystatesindistillation-caltechthesis | 2 | 0 % |
| dimensional stack up impeller and diffuser | 2 | 0 % |
| pete trautman | 2 | 0 % |
| high-strength concrete subjected to triaxial compression | 2 | 0 % |
| http //thesis.library.caltech.edu/4412/ | 2 | 0 % |
| introduction of thesis | 2 | 0 % |
| propertiesofanarbitrarilydopedfield-effecttransistor-caltechthesis | 2 | 0 % |
| itemswhereyearis1980-caltechthesis | 2 | 0 % |
| hopf equation | 2 | 0 % |
| geologyoftheramonapegmatites sandiegocounty california-caltechthesis | 2 | 0 % |
| photophysical process | 2 | 0 % |
| optoelectricdevicesforopticalmemorysystems-caltechthesis | 2 | 0 % |
| directional sensitivity liquid crystalls shear | 2 | 0 % |
| http //174.123.30.15 | 2 | 0 % |
| lateralvibrationsasrelatedtostructuralstability-caltechthesis | 2 | 0 % |
| financial derivatites thailand | 2 | 0 % |
| b.a.mazin doctor thesis microwave kinetic inductance detectors . 2004 | 2 | 0 % |
| opticalspectroscopicstudiesofsquareplanard8dimers-caltechthesis | 2 | 0 % |
| co2 lasers discertation | 2 | 0 % |
| anewapproachtotheanalysisoflargedeflectionsofplates-caltechthesis | 2 | 0 % |
| itemswhereoptionis planetaryscience -caltechthesis | 2 | 0 % |
| multicellular aggregation | 2 | 0 % |
| 鈥渇astprep 24鈥 and 鈥渕p biomedicals鈥 | 2 | 0 % |
| researchonthenormalbutenes-caltechthesis | 2 | 0 % |
| solar energy ph d etd | 2 | 0 % |
| j. gao 鈥渢he physics of superconducting microwave resonators | 2 | 0 % |
| citation network analysis thesis | 2 | 0 % |
| isosteric heat of adsorption | 2 | 0 % |
| studiesontheperformanceofarocketpropelledorbitingmissile-caltechthesis | 2 | 0 % |
| crossmodalinteractioninhumans-caltechthesis | 2 | 0 % |
| spectroscopiccharacterizationofdna-mediatedchargetransfer-caltechthesis | 2 | 0 % |
| decomposition nitric acid | 2 | 0 % |
| electron impact ionization molecules | 2 | 0 % |
| typedgravitationalfields-caltechthesis | 2 | 0 % |
| right hemisphere gestalt | 2 | 0 % |
| plasmonicnanoparticlesforoptofluidicapplications-caltechthesis | 2 | 0 % |
| thesis arc discharge | 2 | 0 % |
| wavelength diversity | 2 | 0 % |
| enantioselective organocatalytic friedel-crafts alkylations | 2 | 0 % |
| large-eddysimulationofmarinecumulusandstratocumulusandstudyofhumidityhalosandaerosolindirectradiativeeffect-caltechthesis | 2 | 0 % |
| egf wntandhoxinteractionsduringpatterningofcaenorhabditiselegansequivalencegroups-caltechthesis | 2 | 0 % |
| elastostaticinteractionofcracksintheinfiniteplane-caltechthesis | 2 | 0 % |
| thepfaffianschurprocess-caltechthesis | 2 | 0 % |
| phonons in carbon nanotubes | 2 | 0 % |
| laser yag yg661 | 2 | 0 % |
| phonon drag in low-doped semiconductor | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-04 -refererse | 2 | 0 % |
| itemswhereoptionis socialscience -caltechthesis | 2 | 0 % |
| i.shockmetamorphismofthecoconinosandstoneatmeteorcrater arizona.ii.thespecificheatofsolidsofgeophysicalinterest-caltechthesis | 2 | 0 % |
| synthesis of unnatural amino acids barbara imperiali | 2 | 0 % |
| stm study of superconducting nanoparticles on graphene | 2 | 0 % |
| http //thesis.library.caltech.edu/3438/1/hofmann_phd.pdf | 2 | 0 % |
| knuth semifields | 2 | 0 % |
| geology of chatsworth ca 91304 | 2 | 0 % |
| distribution of velocity and temperature between concentric rotating cylinders | 2 | 0 % |
| studiesofexperimentaltechniquesforsoundingtheionosphereatlowandverylowradiowavefrequencies-caltechthesis | 2 | 0 % |
| highresolutionlaserspectroscopyofsupersonicjet-cooledmolecules-caltechthesis | 2 | 0 % |
| propanesultone 2.7 g 22 mmol was dissolved in dry thf 50 ml | 2 | 0 % |
| manufacturingofperchloricacid-caltechthesis | 2 | 0 % |
| sizingaerosolparticlesbetweenoneandthreenanometers-caltechthesis | 2 | 0 % |
| nitric acid decomposition temperature | 2 | 0 % |
| resumo | 2 | 0 % |
| itemswhereoptionis physics andyearis1953-caltechthesis | 2 | 0 % |
| biosensing technology pdf | 2 | 0 % |
| error-correctioncodingforreliablecommunicationinthepresenceofextremenoise-caltechthesis | 2 | 0 % |
| theeffectofgeneralimperfectionsonthebucklingofcylindricalshells-caltechthesis | 2 | 0 % |
| manyfacesofyoungneutronstars-caltechthesis | 2 | 0 % |
| thetip-sampleinteractioninatomicforcemicroscopyanditsimplicationsforbiologicalapplications-caltechthesis | 2 | 0 % |
| hoso2路 | 2 | 0 % |
| lasso signal | 2 | 0 % |
| azotobacter vinelandii pdf | 2 | 0 % |
| anexperimentalinvestigationofthebehaviorofcarbondioxideinrhyoliticmelt-caltechthesis | 2 | 0 % |
| a linearized model using transfer matrix to study the forced whirling of centrifugal pump systems pd | 2 | 0 % |
| infraredspectroscopyofmolecularionsandion-solventclusters-caltechthesis | 2 | 0 % |
| shock waves in elastic and elastic-plastic media | 2 | 0 % |
| fluorescentpeptidylchemosensorsforthemeasurementofdivalentmetalcationconcentrations-caltechthesis | 2 | 0 % |
| synthesis characterizationandreactivityofsomepermethyltantalocenealkylidenesandunusuallystablemetallaoxetanes-caltechthesis | 2 | 0 % |
| conversionsofbeta-caroteneandsomerelatedpolyenestoketoandhydroxyderivativesbymeansofn-bromosuccinimideandborontrifluorides-caltechthesis | 2 | 0 % |
| praseodymiumandneodymiumcomplexeswith8-quinolinol-5-sulfonicacid.somereactionsofnitrosyldisulfonateion-caltechthesis | 2 | 0 % |
| thedielectricrecoveryofparallelarcs-caltechthesis | 2 | 0 % |
| phd dissertation synthetic oscillators | 2 | 0 % |
| thesuitabilityofsomecaliforniagrowneucalyptsforpaperpulp-caltechthesis | 2 | 0 % |
| neu thesis california institute | 2 | 0 % |
| developmentofiminium-activationtechnologiesandthetotalsynthesisof -frondosinb-caltechthesis | 2 | 0 % |
| predictionofstructuresandpropertiesfororganicsuperconductors-caltechthesis | 2 | 0 % |
| platinum based bulk metallic glass | 2 | 0 % |
| control flexible structure | 2 | 0 % |
| efficientautomaticengineeringdesignsynthesisviaevolutionaryexploration-caltechthesis | 2 | 0 % |
| astudyofsomeproblemsaffectingthedesignofwingsfortransonicaircraft-caltechthesis | 2 | 0 % |
| selectflour alpa fluorination of aldehydes | 2 | 0 % |
| experimentsonthewall-pressurehistoryinshockreflectionprocesses-caltechthesis | 2 | 0 % |
| itemswhereoptionis computerscience andyearis2009-caltechthesis | 2 | 0 % |
| minimumdragduetoliftforadeltawingwithsonicleadingedges-caltechthesis | 2 | 0 % |
| macrocylictetraamido-nligandsthatstabilizehighvalentcomplexesofchromium manganese iron cobalt nickel andcopper-caltechthesis | 2 | 0 % |
| advantages of modularity in engineering design | 2 | 0 % |
| pentene with hydrogen bromide | 2 | 0 % |
| photonicwhispering-galleryresonatorsinnewenvironments-caltechthesis | 2 | 0 % |
| nonlineareffectsintravelingwavelaseramplifiers-caltechthesis | 2 | 0 % |
| itemswhereoptionis geology andyearis1929-caltechthesis | 2 | 0 % |
| coalinga middle school students | 2 | 0 % |
| glialcelldevelopmentinthevertebratecentralnervoussystem-caltechthesis | 2 | 0 % |
| condensermotorwithhighstartingtorqueandlowcapacitance-caltechthesis | 2 | 0 % |
| cambrian liu grueneberg | 2 | 0 % |
| precipitate design for creep strengthening of 9% cr thesis | 2 | 0 % |
| catalyzed claisen rearrangement | 2 | 0 % |
| dust devils thesis | 2 | 0 % |
| neuroeconomics vs behavioral economics | 2 | 0 % |
| aninvestigationoftheeffectsofearthquakesonbuildings-caltechthesis | 2 | 0 % |
| to study the 2 4 d translocation process | 2 | 0 % |
| application of detection and tracking of objects | 2 | 0 % |
| solar powered sterling generator for drip irrigation | 2 | 0 % |
| plot the cyclic-voltammetry data highlighting the difference between photoelectrodes having no catalyst on the surface and photoelectrodes having pt on the surface. | 2 | 0 % |
| sheet metal formula design | 2 | 0 % |
| theuseofjunctiontransistorsinswitchingcircuits-caltechthesis | 2 | 0 % |
| us patents functionalized carbon nanotubes | 2 | 0 % |
| topicsinnumericalrelativity theperiodicstanding-waveapproximation thestabilityofconstraintsinfreeevolution andthespinofdynamicalblackholes-caltechthesis | 2 | 0 % |
| flat nonlinear systems | 2 | 0 % |
| non-contact measurement of crystallization behavior specific volume and viscosity of bulk glass-forming zr-al-co- cu alloys | 2 | 0 % |
| thegeologyofthehousercanyonpegmatitewithanx-rayanalysisofmanazite-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2012-02 -unknownos | 2 | 0 % |
| micro-photographicrecordofweathermaps-caltechthesis | 2 | 0 % |
| hawaiian basalt composition | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2005-08 -keywords | 2 | 0 % |
| xps for hwcvd silicon nitride films | 2 | 0 % |
| the physics of simultaneously colliding particles at the same space and time | 2 | 0 % |
| itemswhereoptionis computationandneuralsystems andyearis2008-caltechthesis | 2 | 0 % |
| 锝冿絹锝屻锝旓絽锝冿綀銆锝勶綁锝擄綋锝咃綊锝旓絹锝旓綁锝忥綆銆锛掞紣锛戯紨 | 2 | 0 % |
| itemswhereoptionis appliedmechanics andyearis1987-caltechthesis | 2 | 0 % |
| jet-like flow swimmer low reynolds number | 2 | 0 % |
| failure of thin cylinder | 2 | 0 % |
| formationandstabilityofnanocrystallinealloyssynthesizedbymechanicalmilling-caltechthesis | 2 | 0 % |
| replication cycle of phi ex 174 | 2 | 0 % |
| imaging with second-harmonic generation nanoparticles | 2 | 0 % |
| mechanics of ciliary locomotion | 2 | 0 % |
| dispersioninphotoniccrystals-caltechthesis | 2 | 0 % |
| mosek.h | 2 | 0 % |
| capm beta larger | 2 | 0 % |
| cardiovascular fluid mechanics | 2 | 0 % |
| moderndigitalseismology-instrumentation andsmallamplitudestuduesintheengineeringworld-caltechthesis | 2 | 0 % |
| theimpactofasynchronyoncomputerarchitecture-caltechthesis | 2 | 0 % |
| aqueous ring-opening metathesis polymerizations | 2 | 0 % |
| studiesoflevitatedsingledroplets-caltechthesis | 2 | 0 % |
| high speed io link thesis | 2 | 0 % |
| originoftsuamis | 2 | 0 % |
| diffusionandstressdrivenflowinpolymers-caltechthesis | 2 | 0 % |
| itemswhereoptionis astronomy andyearis2008-caltechthesis | 2 | 0 % |
| thallous and thallic ions in thallous chloride | 2 | 0 % |
| robustbilateraltradeandanessayonawarenessasanequilibriumnotion-caltechthesis | 2 | 0 % |
| boundary layer flat plate mach 2.0 schlieren | 2 | 0 % |
| essaysoninformation competition andcooperation-caltechthesis | 2 | 0 % |
| astudyofthereaction6li 12c d 16odegreesabovethecoulombbarrier-caltechthesis | 2 | 0 % |
| big data hardware | 2 | 0 % |
| integrationofanalogvlsiandthinfilmsforchemicalsensingarrays-caltechthesis | 2 | 0 % |
| agalaxyclustersurveyusingthesunyaevzel dovicheffect-caltechthesis | 2 | 0 % |
| i.anx-raydiffractionstudyofthecrystalstructureofcyclopropanecarbohydrazide.ii.atheoryofisotropichyperfineinteractioninpi-electronradicals-caltechthesis | 2 | 0 % |
| novel thermoplastic bonding bulk metallic glass solder | 2 | 0 % |
| refractive index measurements | 2 | 0 % |
| flow many type of technology is.used until now fabricaton of.mos | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis1991-caltechthesis | 2 | 0 % |
| author patrick sanan | 2 | 0 % |
| caltech theofilos | 2 | 0 % |
| diffusion in porous media | 2 | 0 % |
| intro thesis | 2 | 0 % |
| serineproteases theirinhibitors andchitinsynthetaseinphycomyces-caltechthesis | 2 | 0 % |
| design and analysis of network codes | 2 | 0 % |
| integrated magnetics cores design | 2 | 0 % |
| thepreparationoffunctionalizedpolymersbyring-openingmetathesispolymerization-caltechthesis | 2 | 0 % |
| number of sphere in a cylinder | 2 | 0 % |
| isophotometryofbrightestellipticalgalaxiesinrichclusters-caltechthesis | 2 | 0 % |
| analysis of genomic signal using fir filter thesis topics | 2 | 0 % |
| quantifyingquantumnonlocality-caltechthesis | 2 | 0 % |
| ageneticandcytologicalanalysisofatandemduplicationanditsincludedlociindrosophilamelanogaster-caltechthesis | 2 | 0 % |
| i.studyofhydrogenbondingbyinfraredspectroscopyandnuclearmagneticresonance.ii.electronparamagneticresonanceofmn ii complexesinacetonitrile-caltechthesis | 2 | 0 % |
| lateralstabilityofthintaperedstruts-caltechthesis | 2 | 0 % |
| nonlinear nanoelectromechanical system | 2 | 0 % |
| delamination thesis buckling pdf laminate | 2 | 0 % |
| thesis for wireless network | 2 | 0 % |
| analysisofmillimeterandmicrowaveintegratedcircuits-caltechthesis | 2 | 0 % |
| avg | 2 | 0 % |
| singh vritika | 2 | 0 % |
| matstat potentiostat control software | 2 | 0 % |
| allintitle methanotrophs | 2 | 0 % |
| volatile organic compound air pollution | 2 | 0 % |
| micrornas155and125bphysiologicallyandpathologicallyregulatehematopoiesisandimmunity-caltechthesis | 2 | 0 % |
| aninvestigationoftheomegatrontypemassspectrometer-caltechthesis | 2 | 0 % |
| best p.hd acknowledgment | 2 | 0 % |
| kdv moving | 2 | 0 % |
| pursue my degree | 2 | 0 % |
| segregated differential equation | 2 | 0 % |
| geologicandisotopicinvestigationsoftheearlycretaceoussierranevadabatholith tulareco. ca andtheivreazone nwitalianalps examplesofinteractionbetweenmantle-derivedmagmaandcontinentalcrust-caltechthesis | 2 | 0 % |
| coulometricandamperometricstudies-caltechthesis | 2 | 0 % |
| length scale change in vitreous body | 2 | 0 % |
| list stability and mixing | 2 | 0 % |
| heavy minerals | 2 | 0 % |
| silicon nanostructure photovoltaic | 2 | 0 % |
| constitutive modeling of brain tissue using ogden-type strain energy functions | 2 | 0 % |
| itemswhereoptionis chemistry andyearis1955-caltechthesis | 2 | 0 % |
| http //thesis.library.caltech.edu/4778/ | 2 | 0 % |
| microwave kinetic inductance detector | 2 | 0 % |
| itemswhereoptionis aeronautics andyearis1984-caltechthesis | 2 | 0 % |
| crystallization thermodynamics | 2 | 0 % |
| streamingbirefringencestudyoftheinteractionsofsubmicroscopicparticles-caltechthesis | 2 | 0 % |
| molecular docking studies thesis | 2 | 0 % |
| wgm polarmodenumber phasematch | 2 | 0 % |
| adsorption pdf | 2 | 0 % |
| creep fault | 2 | 0 % |
| michael winterrose caltech | 2 | 0 % |
| studyofsphericalcouetteflowvia3-dspectralsimulations largeandnarrow-gapflowsandtheirtransitions-caltechthesis | 2 | 0 % |
| thereductionpotentialofpentavalentvanadiumtovanadylioninhydrochloricacidsolutions.fluoresenzversuchasorganischedaempfe besondersanaceton.studiesofthenatureandreactionsofoxidizedsilvercompounds especiallyinnitricacid.-caltechthesis | 2 | 0 % |
| dar hajimiri | 2 | 0 % |
| caltech phd thesis | 2 | 0 % |
| acknowledgements phd thesis | 2 | 0 % |
| recall in neural network | 2 | 0 % |
| oxidationofvalericacid-caltechthesis | 2 | 0 % |
| simulation of controlled bluff body flow with a viscous vortex method | 2 | 0 % |
| scanningprobechemicalandtopographicalmicroanalysis-caltechthesis | 2 | 0 % |
| pram concurrency | 2 | 0 % |
| thesis of polymers 2013 | 2 | 0 % |
| pdf thesis dissertation | 2 | 0 % |
| geologyofthehumphreysstationarea losangelescounty california-caltechthesis | 2 | 0 % |
| qr 鈭 analysis and design of quasi鈭抮esonant converters | 2 | 0 % |
| radio astronomy at 10 megahertz | 2 | 0 % |
| i.multi-scaledynamicsofmantleplumesandii.compressiblethermo-chemicalconvectionandthestabilityofmantlesuperplumes-caltechthesis | 2 | 0 % |
| extraction of gallium from their ore | 2 | 0 % |
| geometric mean decomposition | 2 | 0 % |
| earitifical telephone | 2 | 0 % |
| http //thesis.library.caltech.edu/4668/ | 2 | 0 % |
| quantumcriticalphenomenainsuperfluidsandsuperconductors-caltechthesis | 2 | 0 % |
| explorationofphysisorbedmonolayersformolecular-scalesurfacepatterning-caltechthesis | 2 | 0 % |
| dm thesis | 2 | 0 % |
| controllable switches | 2 | 0 % |
| synthesisofthepolarizationpropertiesofcygnusaat8300and9600megahertz-caltechthesis | 2 | 0 % |
| elastic metallic glass | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2009-09 -unknownbrowser | 2 | 0 % |
| optomechanic | 2 | 0 % |
| www gmaja fata | 2 | 0 % |
| phd thesis fullerene | 2 | 0 % |
| best acknowledgement for thesis | 2 | 0 % |
| oxazole pdf | 2 | 0 % |
| freeph.d thesis on mutual fund | 2 | 0 % |
| http //thesis.library.caltech.edu/4856/ | 2 | 0 % |
| vanes of the centrifugal pump | 2 | 0 % |
| longitudinalmodecombustioninstabilitiesinairbreathingengines-caltechthesis | 2 | 0 % |
| physico-chemicalprocessesbehindshockfronts-caltechthesis | 2 | 0 % |
| filetype pdf palladium reagents in organic reaction | 2 | 0 % |
| itemswhereoptionis environmentalscienceandengineering andyearis1986-caltechthesis | 2 | 0 % |
| sotiris masmanidis | 2 | 0 % |
| someinvestigationsofheterogeneousflowinarocketnozzle-caltechthesis | 2 | 0 % |
| area costandresiliencetargetsforheatexchangernetworks-caltechthesis | 2 | 0 % |
| patterns of flow thesis | 2 | 0 % |
| itemswhereoptionis chemicalengineering andyearis1960-caltechthesis | 2 | 0 % |
| ion-beammixingandtheformationofamorphousalloys-caltechthesis | 2 | 0 % |
| thedevelopmentoflow-ordermodelsforthestudyoffluid-structureinteraction-caltechthesis | 2 | 0 % |
| protein-ligand interactions | 2 | 0 % |
| hydrogen storage pdf | 2 | 0 % |
| holocenestratigraphyandchronologyofmountainmeadows sierranevada california-caltechthesis | 2 | 0 % |
| stz formation volume and energy probability distribution mayr | 2 | 0 % |
| discrete hodge star operator is backward difference of forward | 2 | 0 % |
| acid _ base catalyst of mesoporous material | 2 | 0 % |
| kac-moody algebra | 2 | 0 % |
| antelope valley ca geology | 2 | 0 % |
| thestratigraphyandforaminiferalfaunaofthesantasusanaformation-caltechthesis | 2 | 0 % |
| drosophila flight | 2 | 0 % |
| multiratesignalprocessingconceptsindigitalcommunications-caltechthesis | 2 | 0 % |
| manuel monge caltech | 2 | 0 % |
| iterative decoders for the turbo-like codes f-ldpc | 2 | 0 % |
| the development of the u-th /he thermochronometer | 2 | 0 % |
| dynamics noiseproperties andspectralcharacteristicsofsemiconductorlaserswithexternalcoupling-caltechthesis | 2 | 0 % |
| stress under driven pile | 2 | 0 % |
| deformation of sedimentary rocks | 2 | 0 % |
| aninvestigationofforcedflexuraltorsionaloscillationsofawingandthephenomenonofflutter-caltechthesis | 2 | 0 % |
| high-sensitivitysearchesforradiopulsars-caltechthesis | 2 | 0 % |
| animal cell lysis buffer without sonication | 2 | 0 % |
| cavitation scale e ects - a presentation of its visual appearance | 2 | 0 % |
| photoelectrochemical cells pdf | 2 | 0 % |
| slobodan cuk phd thesis | 2 | 0 % |
| properties of buried heterostructure single quantum well al ga as lasers | 2 | 0 % |
| micro铿倁idic pdms cytop | 2 | 0 % |
| base random excitation vibration edu | 2 | 0 % |
| distributed estimation and control in networked systems | 2 | 0 % |
| theoreticalstudiesofsiliconsurfacesusingfiniteclusters-caltechthesis | 2 | 0 % |
| applications of coding | 2 | 0 % |
| concurrentdynamicsimulation multicomputeralgorithmsresearchappliedtoordinarydifferential-algebraicprocesssystemsinchemicalengineering-caltechthesis | 2 | 0 % |
| mechanical alloying aluminium | 2 | 0 % |
| someinvestigationsinthebucklingofthinrods-caltechthesis | 2 | 0 % |
| hydrogels introduction | 2 | 0 % |
| thesanandreasfaultzoneinsangorgoniopass california-caltechthesis | 2 | 0 % |
| computationalstrategyincatalystdesign-caltechthesis | 2 | 0 % |
| caltech dissertations | 2 | 0 % |
| acknowledgement quotes for thesis | 2 | 0 % |
| m-ary turbo codes | 2 | 0 % |
| nonlinear dynamics of nanoscale systems | 2 | 0 % |
| asymmetric desymmetrization of alkyne | 2 | 0 % |
| equilibrium water seasonally | 2 | 0 % |
| ddm azolectin freeze and thaw | 2 | 0 % |
| opticalnanocavitiesintwo-dimensionalphotoniccrystalplanarwaveguides-caltechthesis | 2 | 0 % |
| fos necklace glomeruli | 2 | 0 % |
| photoproductionofneutralpionsfromprotonsintheforwarddirectionintheregionofthesecondandthirdresonances-caltechthesis | 2 | 0 % |
| variationalstudiesofexoticboseliquid spinliquid andmagneticphases-caltechthesis | 2 | 0 % |
| modulation of magnetic properties in magnetic resonance imaging contrast agents and molecular magnetic materials | 2 | 0 % |
| degradationofpicturequalitybyspeckleincoherentmappingsystems-caltechthesis | 2 | 0 % |
| degine issues in personal wireleus system | 2 | 0 % |
| infrared specular reflection calculated for polymer films on polymer substrates models for the spectra of coated plastics | 2 | 0 % |
| supermassiveblackholesingalacticnuclei-caltechthesis | 2 | 0 % |
| interferenceeffectsduringburninginairfortwostationaryn-heptanedroplets-caltechthesis | 2 | 0 % |
| mineralogyandpetrologyoftheolivinediabasesillcomplexandassociatedunusuallypotassicgranophyres sierraancha centralarizona-caltechthesis | 2 | 0 % |
| thesis perchloric acid production | 2 | 0 % |
| eastern transverse ranges | 2 | 0 % |
| itemswhereoptionis computerscience andyearis1996-caltechthesis | 2 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1988-caltechthesis | 2 | 0 % |
| itemswhereoptionis biology andyearis1969-caltechthesis | 2 | 0 % |
| computer-aidedmodelingandanalysisofpassivemicrowaveandmillimeter-wavehigh-temperaturesuperconductorcircuitsandcomponents-caltechthesis | 2 | 0 % |
| skin fiction active drag reduction | 2 | 0 % |
| i.photochemicalreactionsofphenylcyclobutadienoquinone.ii.thermalreactionsofphenylcyclobutadienoquinoneinmethanol.iii.thephotochemicalsynthesisofphenanthrenes-caltechthesis | 2 | 0 % |
| anexperimentalstudyoftheflowofasubsonicandturbulentboundarylayeroveraforward-facingstep-caltechthesis | 2 | 0 % |
| fe3si chemical | 2 | 0 % |
| generalized valence bond states | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-12 -unknownbrowser | 2 | 0 % |
| catalystsforolefinmetathesis rutheniumalkylidenecomplexeswithphosphineandn-heterocycliccarbeneligands-caltechthesis | 2 | 0 % |
| microwaveinteractionwithboundedgyroelectricplasmas-caltechthesis | 2 | 0 % |
| rohon beard humans | 2 | 0 % |
| millimeter-waveintegrated-circuithorn-antennaimagingarrays-caltechthesis | 2 | 0 % |
| jinghao huang caltech | 2 | 0 % |
| accurateinteratomicpotentialsforsimulations-caltechthesis | 2 | 0 % |
| dna triple helix ph | 2 | 0 % |
| ethane hydrate promoter | 2 | 0 % |
| sonochemical reactor | 2 | 0 % |
| laurence lumes | 2 | 0 % |
| metallic glass california institute of technology | 2 | 0 % |
| sarohia | 2 | 0 % |
| microphone flow past cylinder | 2 | 0 % |
| kristen john caltech | 2 | 0 % |
| opticsatthenanoscale lightemissioninplasmonicnanocavities-caltechthesis | 2 | 0 % |
| biochemical biophysical andcellularinvestigationsoftheinteractionsoftransferrinreceptorwithtransferrinandthehereditaryhemochromatosisprotein hfe-caltechthesis | 2 | 0 % |
| evolutionary thesis represents one of the most profound theories of all time | 2 | 0 % |
| targetingproteinsforubiquitinationanddegradationinthetreatmentofhumandisease-caltechthesis | 2 | 0 % |
| waveguidepackagingofquasi-opticalgridamplifiers-caltechthesis | 2 | 0 % |
| naturalconvectionflowsandassociatedheattransferprocessesinroomfires-caltechthesis | 2 | 0 % |
| anexperimentalstudyoftheinteractionofwaterwithgraniticmelt-caltechthesis | 2 | 0 % |
| lohman sw 1937 ground water in northeastern pennsylvania. | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2006-07 -main | 2 | 0 % |
| introduction to metallic glasses | 2 | 0 % |
| decision making | 2 | 0 % |
| atomic-level plasticity | 2 | 0 % |
| compressiblevorticesandshock-vortexinteractions-caltechthesis | 2 | 0 % |
| shelby elastic | 2 | 0 % |
| analysisofimagesequencesusingredundantrepresentations-caltechthesis | 2 | 0 % |
| stressesattwo-dimensionalcornersforvariousforcedistributions-caltechthesis | 2 | 0 % |
| bibliography thesis | 2 | 0 % |
| wei mao caltech hassibi | 2 | 0 % |
| stress in a thin cylindrical shell | 2 | 0 % |
| howard zebker | 2 | 0 % |
| characterisation of radiation induced damage to semiconductors | 2 | 0 % |
| nucleationandcondensationalgrowthofaerosols applicationtosiliconproduction-caltechthesis | 2 | 0 % |
| total synthesis | 2 | 0 % |
| photocatalysisunderperiodicillumination-caltechthesis | 2 | 0 % |
| statisticsforthesis.library.caltech.edu 2010-03 -allhosts | 2 | 0 % |
| 4fe4s cluster mutyh | 2 | 0 % |
| robust sentence | 2 | 0 % |
| phd thesis pdf on mars and terrestrial analogues | 2 | 0 % |
| excitationanddampingofsolarp-modes-caltechthesis | 2 | 0 % |
| effect of ligands structure on metallocene polymerization pdf | 2 | 0 % |
| itemswhereoptionis mathematics andyearis2002-caltechthesis | 2 | 0 % |
| why does aluminum age after heat treat | 2 | 0 % |
| synthesisandreactivityoftransitionmetalmethylidenecomplexes-caltechthesis | 2 | 0 % |
| thenumericalcalculationofthree-dimensionalwaterwavesusingaboundaryintegralmethod-caltechthesis | 2 | 0 % |
| applicationsofanedge-and-cornerlayertechniquetoelasticplatesandshells-caltechthesis | 2 | 0 % |
| silicon-based terahertz circuits and systems | 2 | 0 % |
| itemswhereoptionis appliedandcomputationalmathematics andyearis1994-caltechthesis | 2 | 0 % |
| i.surfacedeformationsinadrainingcylindricaltank.ii.stabilityofalaminarfilmonaninclinedplane-caltechthesis | 2 | 0 % |
| parti.3 4-diazabenzvalene theazoalkaneprecursortotetrahedrane.partii.magneticpropertiesofpolaronicpolymers-caltechthesis | 2 | 0 % |
| geologyofthenorthhalfofthewhitemountainquadrangle california-nevada.petrographyofthenorthhalfofthewhitemountainsquadrangle california-nevada.stratigraphyandfaunalrelationshipsofpliocenebedsofsandiegoageinthevicinityoflasllajascanyon simivalley california-caltechthesis | 2 | 0 % |
| ontheconcentrationofspacechargeinthevicinityofaninsulatingsurface-caltechthesis | 2 | 0 % |
| construction of biological oscillators dissertation thesis | 2 | 0 % |
| abinitiocalculationsinheterogeneousandhomogeneouscatalysis i.methanoltogasolinewithzsm-5.ii.carbonylligandeffectsonmetal-metalbonds-caltechthesis | 2 | 0 % |
| globalanalysisofdynamicepigeneticmarkingandtranscriptionalregulationunderlyingt-celllineagecommitment-caltechthesis | 2 | 0 % |
| essay for microeconomic | 2 | 0 % |
| high-enthalpyshock/boundary-layerinteractiononadoublewedge-caltechthesis | 2 | 0 % |
| exploratorystudiesofopen-channelflowoverlaterallyvaryingroughness-caltechthesis | 2 | 0 % |
| fiber-coupled ultra-high-q microresonators for nonlinear and quantum optics | 2 | 0 % |
| data storage collected for dissertation | 2 | 0 % |
| 2-pentene hbr | 2 | 0 % |
| antibody and click chemistry and cancer and dissertation | 2 | 0 % |
| soilstressfieldarounddrivenpiles-caltechthesis | 2 | 0 % |
| newmethodsofsolvingtheequationsfortheflowofacompressiblefluid-caltechthesis | 2 | 0 % |
| photoproductionofpositivek-mesonsinhydrogenatlargecenterofmassangles-caltechthesis | 2 | 0 % |
| xps for hwcvd silicon nitride | 2 | 0 % |
| thomas j. johnson caltech | 2 | 0 % |
| developmentalregulationandchromosomaldecondensationofthe68cgluegeneclusterindrosophilamelanogaster-caltechthesis | 2 | 0 % |
| arsenate respiratory reductase arrab crystal structure | 2 | 0 % |
| dissertation on price mechanism pdf | 2 | 0 % |
| Other phrases | 5101 | 64.6 % |