6812 different keyphrases | Search | Percent |
reflection experiments methods | 82 | 0.8 % |
browsebydegree/thesistype-caltechthesis | 75 | 0.8 % |
arash yavari | 58 | 0.6 % |
null | 38 | 0.4 % |
browsebydegree-caltechthesis | 35 | 0.3 % |
http //thesis.library.caltech.edu/7337/ | 31 | 0.3 % |
caltech thesis | 29 | 0.3 % |
browsebyauthor-caltechthesis | 24 | 0.2 % |
modelling and analysis switching converter | 24 | 0.2 % |
browsebyadvisor-caltechthesis | 23 | 0.2 % |
browsebycommitteemember-caltechthesis | 20 | 0.2 % |
browsebyeprintid-caltechthesis | 20 | 0.2 % |
distribution of turbulent viscosity pipe flow | 17 | 0.1 % |
thesis acknowledgement | 16 | 0.1 % |
appendix in thesis | 14 | 0.1 % |
caltech library | 13 | 0.1 % |
sp1 gda | 11 | 0.1 % |
bennett lake alaska | 10 | 0.1 % |
jurgen wasser chemistry caltech | 10 | 0.1 % |
t. n. irvine | 9 | 0 % |
run-upandnonlinearpropagationofoceanicinternalwavesandtheirinteractions-caltechthesis | 9 | 0 % |
theory of satellite | 9 | 0 % |
aurora borealis | 8 | 0 % |
thesis.library.caltech.edu | 8 | 0 % |
http //thesis.library.caltech.edu/8050/1/wiggenhorn_david_craig_2014_thesis.pdf | 8 | 0 % |
http //thesis.library.caltech.edu/2441/1/knuth_de_1963.pdf | 8 | 0 % |
sidao ni 2013 | 8 | 0 % |
viton coating solvent resistance | 8 | 0 % |
thesis introduction | 7 | 0 % |
los angeles tertiary basin | 7 | 0 % |
mechanisms for liquid phase hydrolyses of chlorobenzene and halotoluenes | 7 | 0 % |
samarium doped ba perovskite | 7 | 0 % |
kdipc | 7 | 0 % |
areviewoftheliteratureonthecomptoneffect-caltechthesis | 7 | 0 % |
interactionofaquantumsystemwithastrongoscillatingfield-caltechthesis | 6 | 0 % |
satellite theory | 6 | 0 % |
ahmet akgiray wife | 6 | 0 % |
thesis library | 6 | 0 % |
neurofinance | 6 | 0 % |
cavityoptomechanicsinphotonicandphononiccrystals engineeringtheinteractionoflightandsoundatthenanoscale-caltechthesis | 6 | 0 % |
acknowledgement thesis | 6 | 0 % |
doctoral thesis on the inlet air missile | 6 | 0 % |
geology in myanmar | 6 | 0 % |
sources of mutagens | 6 | 0 % |
dissertation caltech 2013 | 6 | 0 % |
http //thesis.library.caltech.edu/7880/1/thesis.pdf | 6 | 0 % |
rijke tube made of quartz glass and nichrome heater. | 6 | 0 % |
best acknowledgement for thesis | 6 | 0 % |
nuclearinteractionsinahighenergymultiplatecloudchamber-caltechthesis | 6 | 0 % |
bubble collapse filetype pdf | 6 | 0 % |
example of thesis acknowledgment page | 6 | 0 % |
iminium activation phenylboronate | 6 | 0 % |
nawroth_janna_2013_thesis | 5 | 0 % |
alexei y. kitaev caltech | 5 | 0 % |
aspectsofthemorphologicalcharacterandstabilityoftwo-phasestatesinnon-ellipticsolids-caltechthesis | 5 | 0 % |
distributedcontrolandcomputing optimalestimation error-correctingcodes andinteractiveprotocols-caltechthesis | 5 | 0 % |
oxazole | 5 | 0 % |
studyofthestall-spinphenomenausinganalysisandinteractive3-dgraphics-caltechthesis | 5 | 0 % |
alpha chymotrypsin | 5 | 0 % |
wrinkling of dielectric elastomer membranes | 5 | 0 % |
isolationandcharacterizationoffactorsthatinteractwitheukaryotictranscriptionalenhancers-caltechthesis | 5 | 0 % |
i.interactionsoffastandslowwavesinproblemswithtwotimescales.ii.anumericalexperimentonthestructureoftwo-dimensionalturbulentflow-caltechthesis | 5 | 0 % |
r -3 3 -dibromo-binol | 5 | 0 % |
web | 5 | 0 % |
introduction of thesis | 5 | 0 % |
crossmodalinteractioninhumans-caltechthesis | 5 | 0 % |
liu centurion panotopoulos | 5 | 0 % |
publications | 5 | 0 % |
themicrowavethermalthrusteranditsapplicationtothelaunchproblem-caltechthesis | 5 | 0 % |
avg | 5 | 0 % |
cathodoluminescence caltech | 5 | 0 % |
noiseproducedbytheinteractionofacousticwavesandentropywaveswithhigh-speednozzleflows-caltechthesis | 5 | 0 % |
xiankai sun thesis | 5 | 0 % |
theinteractionofsubductingslabsandthe670kilometerdiscontinuity-caltechthesis | 5 | 0 % |
thestructureofstronginteractionsymmetries-caltechthesis | 5 | 0 % |
thesis acknowledgements | 5 | 0 % |
rangedependentsignalsandmaximumentropymethodsforunderwateracoustictomography-caltechthesis | 5 | 0 % |
variationalstudiesofexoticboseliquid spinliquid andmagneticphases-caltechthesis | 5 | 0 % |
sonochemical michael hoffmann pfos thesis | 5 | 0 % |
theinteractionofroussarcomavirusandcellsinvitro-caltechthesis | 5 | 0 % |
richtmyer-meshkov instability | 5 | 0 % |
anisotropiesandinteractionsinshearflowofmacromolecularsuspensions-caltechthesis | 5 | 0 % |
azotobacter | 5 | 0 % |
http //etd.caltech.edu | 5 | 0 % |
dissertation acknowledgements | 5 | 0 % |
circlepatterns memberlist | 5 | 0 % |
responseofauniformfree-pinnedbeamtolateralsinusoidalandrandomexcitation-caltechthesis | 5 | 0 % |
quasi-opticalcomponentsformillimeterandsubmillimeterwaves-caltechthesis | 4 | 0 % |
incidence angle reaction probability | 4 | 0 % |
vitreous humor | 4 | 0 % |
chicken thesis | 4 | 0 % |
some gas diffusion problems | 4 | 0 % |
caltechthesis | 4 | 0 % |
ahmed akgiray | 4 | 0 % |
investigationsofplasmid-hostcellinteractionsinrecombinantescherichiacolipopulations-caltechthesis | 4 | 0 % |
tectonichistoryoftheosbournspreadingcenteranddynamicsubsidenceofthecongobasin-caltechthesis | 4 | 0 % |
dedication thesis | 4 | 0 % |
itemswhereoptionis civilengineering andyearis1924-caltechthesis | 4 | 0 % |
anapplicationofthemethodofcharacteristicstoaxiallysymmetricsupersonicflow-caltechthesis | 4 | 0 % |
interactionsbetweentroposphericchemistryandaerosolsinaunifiedgcmsimulation-caltechthesis | 4 | 0 % |
shockwave lithotripsy | 4 | 0 % |
formationofcranialsensoryganglia roleofneuralcrestcplacodeinteractions slitcrobo andcadherins-caltechthesis | 4 | 0 % |
invitrofluiddynamicsofprostheticaorticheartvalvesinsteadyandpulsatileflow-caltechthesis | 4 | 0 % |
rheologicalbehaviorofcolloidalsuspensions theeffectsofhydrodynamicinteractions-caltechthesis | 4 | 0 % |
models of bottom-up and top-down visual attention | 4 | 0 % |
helia naeimi | 4 | 0 % |
thesis on macromolecules | 4 | 0 % |
hydrogels pdf | 4 | 0 % |
slender body | 4 | 0 % |
interactionofhydrogenwithnovelcarbonmaterials-caltechthesis | 4 | 0 % |
example of appendices in thesis | 4 | 0 % |
experimental details or theoretiscal analysis | 4 | 0 % |
cis-regulatoryanalysisofthekeydevelopmentalgene sox10 inneuralcrestandear-caltechthesis | 4 | 0 % |
geology and oak spring and little tujunga | 4 | 0 % |
aircraft spin | 4 | 0 % |
http //thesis.library.caltech.edu/ | 4 | 0 % |
propellanes | 4 | 0 % |
wayne broughton caltech ph.d. thesis | 4 | 0 % |
zhongwen zhan thesis pdf | 4 | 0 % |
ameasurementofthespin-dependentasymmetryinquasielasticscatteringofpolarizedelectronsfrompolarized^3he-caltechthesis | 4 | 0 % |
laurence yeung thesis | 4 | 0 % |
itemswhereoptionis geochemistry andyearis1971-caltechthesis | 4 | 0 % |
statisticsforthesis.library.caltech.edu 2005-02 -urlexit | 4 | 0 % |
thesis two phase flow | 4 | 0 % |
phd acknowledgements | 4 | 0 % |
interactionofweakshockwavesanddiscretegasinhomogeneities-caltechthesis | 4 | 0 % |
circumstellarshellsoflate-typestars--astudyatmillimeterandinfraredwavelengths-caltechthesis | 4 | 0 % |
hydrogen storage | 4 | 0 % |
itemswhereoptionis socialscience andyearis2004-caltechthesis | 4 | 0 % |
deleted in colorectal cancer fn domain | 4 | 0 % |
lateralvibrationsasrelatedtostructuralstability-caltechthesis | 4 | 0 % |
calaa-01 | 4 | 0 % |
acknowledgements thesis | 4 | 0 % |
theinvestigationofgas-phaseion-moleculereactionswithfouriertransformioncyclotronresonancemassspectrometry-caltechthesis | 4 | 0 % |
thermoacoustic instabilities in the rijke tube experiments and modeling | 4 | 0 % |
heat capacity of heavy oils | 4 | 0 % |
atakan peker dissertation | 4 | 0 % |
merrielle spain | 4 | 0 % |
studiesofelectroweakinteractionsandsearchesfornewphysicsusingphotoniceventswithmissingenergyatthelargeelectron-positroncollider-caltechthesis | 4 | 0 % |
theinteractionofflowdiscontinuitieswithsmalldisturbancesinacompressiblefluid-caltechthesis | 4 | 0 % |
itemswhereoptionis mathematics andyearis1955-caltechthesis | 4 | 0 % |
vacuum switch or vacuum interrupter or vacuum valve or vacuum bulb or vacuum circuit breaker or vacuum sectionaliser or insulating material for high voltage or dielectric material and encapsulation or isolation or gas or liquid or solid or ampoule à vide or disjoncteur or interrupteur or sectionneur or contacteur and à vide or isolation éléctrique or matériaux diélectrique or matériaux and d encapsulation or d enrobage or de surmoulage or d extrusion | 4 | 0 % |
parti propertiesofhelicalpolycytidylicacid;partii interactionsofpurinewithproteinsandaminoacids;partiii bindingofbasicproteinstodna-caltechthesis | 4 | 0 % |
information theory and radar mutual information and the design and analysis of radar waveforms and systems | 4 | 0 % |
content | 4 | 0 % |
vortex filiment | 4 | 0 % |
silicon-basedterahertzcircuitsandsystems-caltechthesis | 4 | 0 % |
peter brooks thesis cal tech | 4 | 0 % |
the process of activation of amino acid | 4 | 0 % |
analysisofmillimeterandmicrowaveintegratedcircuits-caltechthesis | 4 | 0 % |
cal tech physics dissertation 2013 | 4 | 0 % |
investigatingsourcesandsinksoforganicaerosols nitrateradicalinitiatedoxidationofisopreneandheterogeneousoxidationoforganicaerosol-caltechthesis | 4 | 0 % |
phd thesis acknowledgement | 4 | 0 % |
a. sorooshian institute of technology thesis | 4 | 0 % |
circlepatterns classmembers | 4 | 0 % |
itemswhereoptionis molecularbiology -caltechthesis | 4 | 0 % |
crosstalkbetweensolublefactorsandcell-cellinteractions implicationsforcellcyclecontrolandtumordevelopment-caltechthesis | 4 | 0 % |
methodsfortheanalysisoforganicchemistryontitan-caltechthesis | 4 | 0 % |
magnetichyperfineinteractionsinsm149inferromagneticsmal2-caltechthesis | 4 | 0 % |
i retrievalofatmosphericcarbondioxidefromhigh-resolutionspectra.ii interannualvariabilityofthestratosphericquasi-biennualoscillation-caltechthesis | 4 | 0 % |
an investigation of ion engine erosion by low energy sputtering | 4 | 0 % |
vacuum switch or vacuum interrupter or vacuum valve or vacuum bulb or vacuum circuit breaker or vacuum sectionaliser or insulating material for high voltage or dielectric material and encapsulation or isolation or gas or liquid or solid or ampoule à vide or disjoncteur or interrupteur or sectionneur or contacteur and à vide or isolation éléctrique or matériaux diélectrique or matériaux and d encapsulation or d enrobage or de surmoulage or d extrusion | 4 | 0 % |
higgsscalarsandthenonleptonicweakinteractions-caltechthesis | 4 | 0 % |
i remotespectroscopicmeasurementsofatmospherichdo/h_2oandcolumnco_2.ii interannualvariationsoftheearth sreflectance-caltechthesis | 4 | 0 % |
anexperimentalstudyoftheinteractionofwaterwithgraniticmelt-caltechthesis | 4 | 0 % |
decision making | 4 | 0 % |
ageneraldifferentialgeometrywithtwotypesoflinearconnection-caltechthesis | 4 | 0 % |
nucleation and condensational growth of aerosols application to silicon production | 4 | 0 % |
the fault line in california lake elsinore | 4 | 0 % |
homepage | 4 | 0 % |
homogeneous nucleation theory | 4 | 0 % |
high-enthalpyshock/boundary-layerinteractiononadoublewedge-caltechthesis | 4 | 0 % |
investigationsofglobalchemistry-climateinteractionsandorganicaerosolusingatmosphericmodeling-caltechthesis | 4 | 0 % |
theinfluenceoftextureonthemagnetoelasticpropertiesofpolycrystallinetbdyalloys-caltechthesis | 3 | 0 % |
aninvestigationofcollisionlessplasmabeaminteractionwithanonhomogeneousmagneticfield-caltechthesis | 3 | 0 % |
transistorswitchinganalysis-caltechthesis | 3 | 0 % |
1930 santa ana cal | 3 | 0 % |
i.thermalandphotosensitizeddimerizationsof1 3-cyclohexadiene.ii.photosensitizedisomerizationofthestilbenes furtherstudies-caltechthesis | 3 | 0 % |
astudyontheformationanddynamicsofgalaxies-caltechthesis | 3 | 0 % |
dynamicsofplasmastructuresinteractingwithexternalandself-generatedmagneticfields-caltechthesis | 3 | 0 % |
theinfiniterangeheisenbergmodelandhightemperaturesuperconductivity-caltechthesis | 3 | 0 % |
i.mechanismsforliquidphasehydrolysesofchlorobenzeneandhalotoluenes.ii.theproductsfromthereactionofn- 2-bromoallyl -ethylaminewithsodiumamide.iii.thenitrogeninversionfrequencyincyclicimines.iv.thenuclearmagneticresonancespectrumoffeist sacid-caltechthesis | 3 | 0 % |
thesis data analysis | 3 | 0 % |
experimentalinvestigationofgasphaseandsurfacephenomenainaseededplasma-caltechthesis | 3 | 0 % |
itemswhereoptionis physics andyearis1989-caltechthesis | 3 | 0 % |
siliconmicromachinedmagneticactuatorsforaerodynamicflowcontrolapplications-caltechthesis | 3 | 0 % |
i.thegeneralizedvalencebonddescriptionofo_2ii.configurationinteractionstudiesonlow-lyingstatesofo_2-caltechthesis | 3 | 0 % |
socialinteractionsandgiving-caltechthesis | 3 | 0 % |
itemswhereoptionis physics andyearis1983-caltechthesis | 3 | 0 % |
dynamicallyconsistentinterpretationoftheseismicstructureatthebaseofthemantle-caltechthesis | 3 | 0 % |
interactionmeasuresforsystemsunderdecentralizedcontrol-caltechthesis | 3 | 0 % |
olfactory system thesis | 3 | 0 % |
interactiveseismicimagingonamulticomputerandapplicationtothehosgrifault-caltechthesis | 3 | 0 % |
terahertz circuits | 3 | 0 % |
anewacridinedye-caltechthesis | 3 | 0 % |
developmentandevaluationofproteindesignmethodsforfunctionaltargets-caltechthesis | 3 | 0 % |
studiesofmetal-organicinteractionswithmodelsyntheticandnaturalligandsapplicabletonaturalwaters-caltechthesis | 3 | 0 % |
astudyofthepolarizationofwaterandmethanolbyvariousdiamagneticionsinanaproticsolvent-caltechthesis | 3 | 0 % |
itemswhereoptionis electricalengineering andyearis1958-caltechthesis | 3 | 0 % |
determinationoftheinteractionpotentialofthenoblegasesfromshockwavestructureexperiments.feasibilityofamodifiedelectronbeamdensitometertechniquetomeasurediffusiveseparationinshockwavesinhelium-argonmixtures-caltechthesis | 3 | 0 % |
polymeric sheets bulging | 3 | 0 % |
quantummechanicsoftheinteractionofgravitywithelectrons theoryofaspin-twofieldcoupledtoenergy-caltechthesis | 3 | 0 % |
http //thesis.library.caltech.edu/7521/ | 3 | 0 % |
magnetofluid | 3 | 0 % |
orbitaldynamicsofkuiperbeltobjectsatellites akuiperbeltfamily andextra-zolarplanetinteriors-caltechthesis | 3 | 0 % |
santa barbara county geology | 3 | 0 % |
hydrogen storage materials | 3 | 0 % |
investigationsoftheaerodynamicinteractionsbetweenwindtunnelmodelsandtheirsupportsystemsatthegalcittenfootwindtunnel-caltechthesis | 3 | 0 % |
observationsofinterstellarmolecularhydrogenemission-caltechthesis | 3 | 0 % |
thefainteststars-caltechthesis | 3 | 0 % |
supersonicfilmcoolingincludingtheeffectofshockwaveinteraction-caltechthesis | 3 | 0 % |
productionanddecayprocessesinvolvingvectormesons-caltechthesis | 3 | 0 % |
california white mountains geology | 3 | 0 % |
silver peak quadrangle | 3 | 0 % |
finitedeflectionsandbucklingofslightlycurvedbeamsandshallowsphericalshellsunderlateralloads-caltechthesis | 3 | 0 % |
astudyoftheeffectsofrepeatedtensionimpactloadsuponcertainmetalsusedinaircraftconstruction-caltechthesis | 3 | 0 % |
kalman filtering equality constraints | 3 | 0 % |
piepgras dissertation | 3 | 0 % |
itemswhereoptionis geologicalandplanetarysciences andyearis1934-caltechthesis | 3 | 0 % |
effectsofdampingandreynoldsnumberonvortex-inducedvibrations-caltechthesis | 3 | 0 % |
stressesnearachangeofthicknessinacontinuous-fiber-compositeplate-caltechthesis | 3 | 0 % |
dependent sample thesis | 3 | 0 % |
designingproteinseparationsbasedonmetal-affinityinteractions-caltechthesis | 3 | 0 % |
opticalandelectricalpropertiesofalpha-monoclinicselenium-caltechthesis | 3 | 0 % |
camptothecin rna delivery | 3 | 0 % |
protein complex elisa | 3 | 0 % |
thestructureandevolutionofinteractingbinarygalaxies-caltechthesis | 3 | 0 % |
investigationsofturbulentmixingregions-caltechthesis | 3 | 0 % |
ubiquitin-proteasomesystematthesynapse-caltechthesis | 3 | 0 % |
dynamicalsimulationandcontrolofarticulatedlimbs-caltechthesis | 3 | 0 % |
thesis format | 3 | 0 % |
constrainedsequentiallamination nonconvexoptimizationandmaterialmicrostructure-caltechthesis | 3 | 0 % |
microfluidictechnologiesforhigh-throughputscreeningapplications-caltechthesis | 3 | 0 % |
cv care work | 3 | 0 % |
studiesofthenonlinearschrodingerequationanditsapplicationtowaterwaves-caltechthesis | 3 | 0 % |
designofnovelbasesforrecognitionofgcbasepairsbyoligonucleotide-directedtriplehelixformation-caltechthesis | 3 | 0 % |
novelpyroelectricandswitchedferroelectricionsourcesinmassspectrometry implementationandapplications-caltechthesis | 3 | 0 % |
experimentalstudyofthereattachmentpressureriseatsubsonicspeeds-caltechthesis | 3 | 0 % |
richard h. price non spherical collapse | 3 | 0 % |
3d photonic crystal thesis | 3 | 0 % |
peptidylacylatingagentsinthepupaeofdrosophilamelanogasterandtheirpossiblerelationshiptoproteinsynthesis-caltechthesis | 3 | 0 % |
unsteady pump | 3 | 0 % |
hydrodynamicsandbrownianmotionofsmallparticlesnearafluid-fluidinterface-caltechthesis | 3 | 0 % |
implantablewirelessintraocularpressuresensors-caltechthesis | 3 | 0 % |
generalizationsofh-infinityoptimization;controlofrotatingstall-caltechthesis | 3 | 0 % |
impactvolatilizationofcalciteandanhydriteandtheeffectonglobalclimatefromk/timpactcrateratchicxulub-caltechthesis | 3 | 0 % |
compare laser beam with a neuron | 3 | 0 % |
http //thesis.library.caltech.edu/1286/ | 3 | 0 % |
acknowledgment thesis | 3 | 0 % |
gas-phaseterahertzspectroscopyandthestudyofcomplexinterstellarchemistry-caltechthesis | 3 | 0 % |
squalene cyclization | 3 | 0 % |
experimentalinvestigationofthethicknessoftheboundarylayerandthelocationofthetransitionalregionalongawingsection-caltechthesis | 3 | 0 % |
gem bearing pegmatite | 3 | 0 % |
arobustcontrolapproachtounderstandingnonlinearmechanismsinshearflowturbulence-caltechthesis | 3 | 0 % |
acknowledgement phd thesis | 3 | 0 % |
dyesensitizationofnanocrystallinetitaniumdioxidewithosmiumandrutheniumpolypyridinecomplexes-caltechthesis | 3 | 0 % |
little tujunga | 3 | 0 % |
silicon microwire arrays | 3 | 0 % |
alimitonthepolarizationofthecosmicmicrowavebackgroundradiation-caltechthesis | 3 | 0 % |
double wedge | 3 | 0 % |
thesis dedication | 3 | 0 % |
quantumstudyoftheh3system-caltechthesis | 3 | 0 % |
sle riemann surface | 3 | 0 % |
floralinitiationincestrumnocturnumthenightbloomingjasmine -caltechthesis | 3 | 0 % |
discretemechanicalinterpolationofkeyframes-caltechthesis | 3 | 0 % |
buchner reaction | 3 | 0 % |
ignition delay kerosene very rich | 3 | 0 % |
planning in an uncertainly and dynamic environment | 3 | 0 % |
itemswhereoptionis planetaryscience -caltechthesis | 3 | 0 % |
mathematicalmodelingandexperimentalstudiesofthermalreactionsofcoal-caltechthesis | 3 | 0 % |
lactosebindingtothee.colisymportproteinlacpermease-caltechthesis | 3 | 0 % |
infraredstudiesofnitrousacid thechloraminesandnitrogendioxide.observationsconcerningthephotochemicaldecompositionofnitricacid-caltechthesis | 3 | 0 % |
interactionofwaterwaveswithadensity-stratifiedfluidinarectangulartrench-caltechthesis | 3 | 0 % |
acknowledgements for phd thesis | 3 | 0 % |
onobtainingpseudorandomnessfromerror-correctingcodes-caltechthesis | 3 | 0 % |
elastostaticinteractionofcracksintheinfiniteplane-caltechthesis | 3 | 0 % |
scalable analysis of nonlinear systems using convex optimization | 3 | 0 % |
demetriades-tsafka-kokkalis prize in nanotechnology or related fields | 3 | 0 % |
optimizingend-to-endsystemperformanceformillimeterandsubmillimeterspectroscopyofprotostars widebandheterodynereceiversandsideband-deconvolutiontechniquesforrapidmolecular-linesurveys-caltechthesis | 3 | 0 % |
deactivationandregenerationkineticsduringbioconversionsbyimmobilizedclostridiumacetobutylicum-caltechthesis | 3 | 0 % |
physical adsorption | 3 | 0 % |
wave heads in tsunami | 3 | 0 % |
thecancellationofrandomdisturbancesinautomaticcontrolsystems-caltechthesis | 3 | 0 % |
directenergybandgapgroupivalloysandnanostructures-caltechthesis | 3 | 0 % |
thechemistryoftris phosphino boratemanganeseandironplatforms-caltechthesis | 3 | 0 % |
itemswhereoptionis geology andyearis1931-caltechthesis | 3 | 0 % |
studyofrnastructurebyaffinitycleaving-caltechthesis | 3 | 0 % |
statisticsforthesis.library.caltech.edu 2010-04 -unknownos | 3 | 0 % |
anomalous microwave emission | 3 | 0 % |
www.caltech.thesis | 3 | 0 % |
thetip-sampleinteractioninatomicforcemicroscopyanditsimplicationsforbiologicalapplications-caltechthesis | 3 | 0 % |
4 hydroxyphenyl acetaldehyde saccharomyces | 3 | 0 % |
studiesonaminoacidactivationandproteinsynthesis-caltechthesis | 3 | 0 % |
itemswhereoptionis physics andyearis1978-caltechthesis | 3 | 0 % |
protein-ligandinteractions docking designandproteinconformationalchange-caltechthesis | 3 | 0 % |
antonio hernandez caltech | 3 | 0 % |
experimentsontheinteractionofamodulatedelectronbeamwithaplasma-caltechthesis | 3 | 0 % |
siliconintegratedoptics fabricationandcharacterization-caltechthesis | 3 | 0 % |
geology of the santa monica mountain | 3 | 0 % |
interacting fermion direct diagonalization examples | 3 | 0 % |
i.themodelockeddyelaser.ii.picosecondphotoconductivityofsemi-insulatinggalliumarsenide-caltechthesis | 3 | 0 % |
signalgenerationandprocessinginhigh-frequency/high-speedsilicon-basedintegratedcircuits-caltechthesis | 3 | 0 % |
acknowledgement sample for thesis | 3 | 0 % |
studiesoflipid-lipidinteractionsinphospholipidbilayermembranes-caltechthesis | 3 | 0 % |
mechanisticinsightsintoalkanec-hactivationandfunctionalizationbymetaloxidesurfacesandorganometalliccomplexes-caltechthesis | 3 | 0 % |
mcpba epoxidation diastereoisomers | 3 | 0 % |
cal tech dissertation 2014 | 3 | 0 % |
a compact design of six component internal strain gauge balance | 3 | 0 % |
hele-shawflownearcuspsingularities-caltechthesis | 3 | 0 % |
r. venkataramanan “sliding mode control of power converters ” ph.d. dissertation california inst. technol. dept. elect. eng. pasadena ca may 1986. | 3 | 0 % |
radioactivepropertiesofrocks soils andwatersofthesoutherncaliforniaregion-caltechthesis | 3 | 0 % |
sedamine analog synthesis | 3 | 0 % |
agency capture | 3 | 0 % |
theregulatorycapacityoftheprotooncogenec-myc-caltechthesis | 3 | 0 % |
computationalmodelingstudiesoffundamentalaerosol-cloudinteractions-caltechthesis | 3 | 0 % |
robustbilateraltradeandanessayonawarenessasanequilibriumnotion-caltechthesis | 3 | 0 % |
scanning tunneling microscope pdf | 3 | 0 % |
circlepatterns mesh halfedgeiteratorclassreference | 3 | 0 % |
approximate differentially flat systems | 3 | 0 % |
harden model in single crystal | 3 | 0 % |
preparationandcharacterizationbystreamingbirefringenceofsodiumdesoxyribonucleate-caltechthesis | 3 | 0 % |
lateralstabilityofthintaperedstruts-caltechthesis | 3 | 0 % |
dualpolarizedandbalancedreceiversatmillimeterandsubmillimeterwavelengths-caltechthesis | 3 | 0 % |
iterativedecodingandpseudo-codewords-caltechthesis | 3 | 0 % |
aninvestigationintotheeffectsofrunningpropellersonthestaticlongitudinalstabilityofmulti-enginetractor-propeller-drivenmonoplanes-caltechthesis | 3 | 0 % |
inverse dynamics for centrifugal pumps pdf | 3 | 0 % |
joseph schaeffer caltech | 3 | 0 % |
sources of mutagen | 3 | 0 % |
geologicandisotopicinvestigationsoftheearlycretaceoussierranevadabatholith tulareco. ca andtheivreazone nwitalianalps examplesofinteractionbetweenmantle-derivedmagmaandcontinentalcrust-caltechthesis | 3 | 0 % |
geologyofthewhitepointoutfallsewertunnel-caltechthesis | 3 | 0 % |
spark ignition experimental and numerical investigation with application to aviation safety | 3 | 0 % |
gailmard 2012 | 3 | 0 % |
http //resolver.caltech.edu/caltechetd etd-10132005-133022 | 3 | 0 % |
hydrodynamicdispersioninconcentratedsedimentingsuspensions-caltechthesis | 3 | 0 % |
cal tech dissertation 2013 | 3 | 0 % |
the von economo neurons from cells to behavior | 3 | 0 % |
itemswhereoptionis chemicalengineering andyearis1978-caltechthesis | 3 | 0 % |
i.impactofvolcanicaerosolsonstratosphericchemistry.ii.o2 1sigmag ando2 1deltag intheh o2reactionsystem.iii.barotropicinstabilityofzonaljetsonmars earthandvenus-caltechthesis | 3 | 0 % |
thesis bibliography | 3 | 0 % |
radiativetransferandopacitycalculations-caltechthesis | 3 | 0 % |
extraction of gallium | 3 | 0 % |
statisticsforthesis.library.caltech.edu 2011-06 -urlentry | 3 | 0 % |
itemswhereoptionis biology andyearis1961-caltechthesis | 3 | 0 % |
74.207.242.236 | 3 | 0 % |
statisticsforthesis.library.caltech.edu 2008-08 -errors404 | 3 | 0 % |
etd caltech | 3 | 0 % |
astudyoffine-grainprogrammingusingcantor-caltechthesis | 3 | 0 % |
modelingandexperimentsforaclassofroboticendoscopes-caltechthesis | 3 | 0 % |
vibrations granular materials applications | 3 | 0 % |
thedevelopmentoflow-ordermodelsforthestudyoffluid-structureinteraction-caltechthesis | 3 | 0 % |
itemswhereoptionis astronomy andyearis1998-caltechthesis | 3 | 0 % |
doping sio2 with metal ions | 3 | 0 % |
multivalentproteinbindingtometal-complexingmaterials applicationstosyntheticreceptorsandaffinitychromatography-caltechthesis | 3 | 0 % |
controllingmolecularandmicrostructuralalignmentinanisotropicpolymersystems-caltechthesis | 3 | 0 % |
aparallelexecutionmodelforlogicprogramming-caltechthesis | 3 | 0 % |
chemicalfractionationatenvironmentalinterfaces-caltechthesis | 3 | 0 % |
role of feedback and dynamics in a gene-regulatory network | 3 | 0 % |
theannualheatbalanceofthemartianpolarcapsfromvikingobservations-caltechthesis | 3 | 0 % |
itemswhereoptionis engineeringandappliedscience andyearis1948-caltechthesis | 3 | 0 % |
thetransportofnonlinearlyadsorbingcompoundsbetweenstreamwaterandsedimentbedinalaboratoryflume-caltechthesis | 3 | 0 % |
fossil bearing sandstone sunland california | 3 | 0 % |
hydrodynamicinteractionsinpolymerdynamics-caltechthesis | 3 | 0 % |
tripletenergydelocalizationinpolynucleotide-acridinecomplexes-caltechthesis | 3 | 0 % |
effectofsmallvariationsofparametersintheturbopropcycle-caltechthesis | 3 | 0 % |
itemswhereyearis1971-caltechthesis | 3 | 0 % |
election thesis | 3 | 0 % |
uniformly valid asymptotic expansion | 3 | 0 % |
caltech and water waves | 3 | 0 % |
olefin polymerization | 3 | 0 % |
c. elegans sex | 3 | 0 % |
microwaveinteractionwithboundedgyroelectricplasmas-caltechthesis | 3 | 0 % |
integrated optic circuit pdf thesis | 3 | 0 % |
dynamicsofmulticellularaggregationanddisaggregation implicationsfortissueengineeringandcancermetastasis-caltechthesis | 3 | 0 % |
statisticsforthesis.library.caltech.edu 2007-01 -urldetail | 3 | 0 % |
san gabriel anorthosite | 3 | 0 % |
stressesattwo-dimensionalcornersforvariousforcedistributions-caltechthesis | 3 | 0 % |
dissertation caltech 2014 | 3 | 0 % |
i.remarksonthearchibaldtechniquefordeterminingmolecularweightsintheultracentrifuge.ii.thehydrodynamicalignmentofrod-likemoleculesincentrifugalfields-caltechthesis | 3 | 0 % |
statisticsforthesis.library.caltech.edu 2005-09 -urlentry | 3 | 0 % |
itemswhereoptionis appliedandcomputationalmathematics andyearis1996-caltechthesis | 3 | 0 % |
jurupa mountains | 3 | 0 % |
rna | 3 | 0 % |
itemswhereoptionis materialsscience andyearis1994-caltechthesis | 3 | 0 % |
http //resolver.caltech.edu/caltechthesis 10312013-102814054 | 3 | 0 % |
location of lake elsinore fault zones map | 3 | 0 % |
theories of flame propagation pdf | 3 | 0 % |
itemswhereoptionis astrophysics andyearis2010-caltechthesis | 3 | 0 % |
exploratorystudiesofopen-channelflowoverlaterallyvaryingroughness-caltechthesis | 3 | 0 % |
simulationsandanalysisoftwo-andthree-dimensionalsingle-moderichtmyer-meshkovinstabilityusingweightedessentiallynon-oscillatoryandvortexmethods-caltechthesis | 3 | 0 % |
anapproximatetheoryforpotentialflowthroughcascadesofairfoils-caltechthesis | 3 | 0 % |
topologicalsigmamodelsandgeneralizedgeometries-caltechthesis | 2 | 0 % |
developmentofaudiovisualintegrationinhumaninfants theeffectsofspatialandtemporalcongruencyandincongruencyonresponselatencies-caltechthesis | 2 | 0 % |
acknowledgement page dissertation | 2 | 0 % |
examples of acknowledgement in thesis | 2 | 0 % |
millimeter/submillimeter fourier transform spectroscopy of jovian planet atmospheres | 2 | 0 % |
structureandfunctionofneuronalpostsynapticdensitiesofthecentralnervoussystem-caltechthesis | 2 | 0 % |
plant cytoplasm proteins | 2 | 0 % |
numericalsimulationsofcombustioninstabilitiesingasturbinecombustors withapplications-caltechthesis | 2 | 0 % |
anexperimentalstudyoftheeffectofmassinjectionatthestagnationpointofabluntbody-caltechthesis | 2 | 0 % |
apathobiontofthemammalianmicrobiotabalancesintestinalinflammationandcolonization-caltechthesis | 2 | 0 % |
i.theanalysisoftherewettingofaverticalslabusingawiener-hopftechnique.ii.asymptoticexpansionsofintegralswiththreecoalescingsaddlepoints-caltechthesis | 2 | 0 % |
coupled-inductorinversion rectificationandcycloconversion-caltechthesis | 2 | 0 % |
volcanic rocks petrogeaphy disseration | 2 | 0 % |
comparison of an electronic nose to a mammalian nose | 2 | 0 % |
aninvertebrateassemblagefromthe modelo formationofreyniercanyon losangeles california.geologyandoriginoftalcdepositsofeasterncalifornia-caltechthesis | 2 | 0 % |
thesis acknowledgement pdf | 2 | 0 % |
geologyofapartofthesouthwesternportionofthesangabrielmountains-caltechthesis | 2 | 0 % |
quantumphasetransitionsindisorderedbosesystems-caltechthesis | 2 | 0 % |
trappedioncyclotronresonancestudiesofion-moleculereactions-caltechthesis | 2 | 0 % |
astudyoftheheavymineralsofthemodeloformationintheeasternportionofthesantamonicamountains-caltechthesis | 2 | 0 % |
y3 ion place in edx sem | 2 | 0 % |
thestudyofaliftingairbreathingboostforsatellitelaunch-caltechthesis | 2 | 0 % |
exploitingthereactivityofarynesinthetotalsynthesisofnaturalproducts-caltechthesis | 2 | 0 % |
temperature independent paramagnetism | 2 | 0 % |
joyce thesis abstract | 2 | 0 % |
itemswhereoptionis appliedmechanics andyearis1966-caltechthesis | 2 | 0 % |
algorithmsformobilerobotlocalizationandmapping incorporatingdetailednoisemodelingandmulti-scalefeatureextraction-caltechthesis | 2 | 0 % |
double wedge airfoil data | 2 | 0 % |
coupled inductor | 2 | 0 % |
automatedperformanceoptimizationofcustomintegratedcircuits-caltechthesis | 2 | 0 % |
ahmed elbanna | 2 | 0 % |
smoothnessoftheintegrateddensityofstatesforrandomschrodingeroperatorsonmultidimensionalstrips-caltechthesis | 2 | 0 % |
estimation of airloads on wings | 2 | 0 % |
tripletexcitonphenomenainbenzenecrystals-caltechthesis | 2 | 0 % |
amino acids biophysics | 2 | 0 % |
vitreloy 1 | 2 | 0 % |
engineeringcytochromep450bm-3forselectivehydroxylationofalkanes-caltechthesis | 2 | 0 % |
birkhoffperiodicorbits aubry-mathersets minimalgeodesicsandlyapunovexponents-caltechthesis | 2 | 0 % |
magneticmicrotrapsforcavityqed bose-einsteincondensates andatomoptics-caltechthesis | 2 | 0 % |
incentives for economics | 2 | 0 % |
why do molecules look the way they do ? | 2 | 0 % |
thekinetictheoryofthesolarwindanditsinteractionwiththemoon-caltechthesis | 2 | 0 % |
nonlinear stochastic stability | 2 | 0 % |
developmentoforganocataltyticdirectaldoltransformations totalsynthesesofbrasosideandlittoralisone andprogresstowardthetotalsynthesisofdiazonamidea-caltechthesis | 2 | 0 % |
adaptation invisible fmri | 2 | 0 % |
inducer pump acosta | 2 | 0 % |
itemswhereoptionis astronomy andyearis1958-caltechthesis | 2 | 0 % |
iterativedecoding-caltechthesis | 2 | 0 % |
aprobabilisticapproachtohumanmotiondetectionandlabeling-caltechthesis | 2 | 0 % |
dna-protein charge transfer | 2 | 0 % |
geologyofthesanjosehills losangelescounty california-caltechthesis | 2 | 0 % |
electronparamagneticresonanceofnitrogenafterglowcondensedat4.2degreesk-caltechthesis | 2 | 0 % |
distributed receding horion control of multiagent system | 2 | 0 % |
solutionstosomeproblemsinmathematicalphysics-caltechthesis | 2 | 0 % |
amodelforthestudyofverynoisychannels andapplications-caltechthesis | 2 | 0 % |
mesylation alkylation | 2 | 0 % |
effectsofimpuritiesonthesupersaturationofnitrogeninahypersonicwindtunnel-caltechthesis | 2 | 0 % |
bm3 p450 hrp arnold | 2 | 0 % |
strain softening definition | 2 | 0 % |
itemswhereoptionis computerscience andyearis1984-caltechthesis | 2 | 0 % |
lionel sydney senhouse jr doctorial thesis | 2 | 0 % |
detectionandpartitioningofbacteriophageinfluid/solidsystems applicationtotheecologyandmobilityofvirusesintheenvironment-caltechthesis | 2 | 0 % |
guoan zheng 2013 thesis | 2 | 0 % |
theelectronicstructureofdistortedporphyinsandcobaltschiffbasederivativesasnovelenzymeinhibitors-caltechthesis | 2 | 0 % |
itemswhereoptionis engineeringandappliedscience andyearis1985-caltechthesis | 2 | 0 % |
computingwithspikingneurons-caltechthesis | 2 | 0 % |
aspecial-purposeelectricanalogcomputeranditsapplicationtothesolutionofcertainnonlineardifferentialequations-caltechthesis | 2 | 0 % |
photoproductionofneutralpionsfromprotonsatcenterofmassanglesof60degrees 90degrees and120degreesfrom.6to1.2bev-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2011-12 -main | 2 | 0 % |
effectsofionizingradiationonaqueoussolutionsofthedetergentalkylbenezenesulfonateandseverallowerhomologs-caltechthesis | 2 | 0 % |
modificationofmembranesurfaceswithcarbohydrates anapproachforstabilizationduringfreezinganddrying-caltechthesis | 2 | 0 % |
designofastandardsuspensiontower-caltechthesis | 2 | 0 % |
acknowledgement phd thesis colleagues pdf | 2 | 0 % |
oxazole introduction | 2 | 0 % |
caltech spectral method | 2 | 0 % |
anil hirani thesis | 2 | 0 % |
05090906 | 2 | 0 % |
alluvial fan pdf | 2 | 0 % |
phb and alcaligenes eutrophus | 2 | 0 % |
analysis and identification of linear and nonlinear normal modes in vibrating systems | 2 | 0 % |
itemswhereoptionis computerscience andyearis1980-caltechthesis | 2 | 0 % |
caltech phd thesis ostby | 2 | 0 % |
cylindrical manifolds and tube dynamics in the restricted three-body problem | 2 | 0 % |
multiple steady states distillation | 2 | 0 % |
retinal prosthesis | 2 | 0 % |
vanishingintegralsforhall-littlewoodpolynomials-caltechthesis | 2 | 0 % |
aninvestigationofflowseparationinanoverextendedsupersonicnozzle-caltechthesis | 2 | 0 % |
kineticsofnucleationandcrystallization-caltechthesis | 2 | 0 % |
auxiliary-fieldmontecarlomethodsforinteractingfermions applicationtothenuclearshellmodel-caltechthesis | 2 | 0 % |
liquid with free surface on the pendulum | 2 | 0 % |
itemswhereoptionis computationandneuralsystems andyearis2011-caltechthesis | 2 | 0 % |
flyback thesis | 2 | 0 % |
anexperimentalinvestigationofheattransferratesonabluntbodyinhypersonicflow-caltechthesis | 2 | 0 % |
diels alder et feast polyacétylene | 2 | 0 % |
sample of appendix on a thesis | 2 | 0 % |
acknowledgments thesis | 2 | 0 % |
syphon spillway | 2 | 0 % |
managing information in networked and multi-agent control systems | 2 | 0 % |
asearchforcosmicmicrowavebackgroundanisotropiesonarcminutescales-caltechthesis | 2 | 0 % |
s1118f | 2 | 0 % |
thesis in impeller | 2 | 0 % |
onquantuminteractingembeddedgeometricalobjectsofvariousdimensions-caltechthesis | 2 | 0 % |
unnatural channel 5 | 2 | 0 % |
caltech patents by john crounse | 2 | 0 % |
itemswhereoptionis engineeringandappliedscience andyearis1968-caltechthesis | 2 | 0 % |
laserdopplervelocityandvorticitymeasurementsinturbulentshearlayers-caltechthesis | 2 | 0 % |
artificialradioactivity-caltechthesis | 2 | 0 % |
batio3 kfm bto | 2 | 0 % |
powell r e 1981 | 2 | 0 % |
structuralstudiesofsomepolynuclearironproteins-caltechthesis | 2 | 0 % |
peter brooks thesis caltech | 2 | 0 % |
attentionandawareness visualpsychophysicsandaversiveconditioninginhumans-caltechthesis | 2 | 0 % |
analysesofatmosphericchf2cl heavyozone hdoandch3dfromatmosspectra-caltechthesis | 2 | 0 % |
cal tech dissertation | 2 | 0 % |
geology of the jackson mountains | 2 | 0 % |
thedevelopmentandutilizationofsomeequipmentforlowreynoldsnumbersupersonicflowresearch-caltechthesis | 2 | 0 % |
optimizedcomputer-generatedmotionsforanimation-caltechthesis | 2 | 0 % |
montebello hills | 2 | 0 % |
optoelectronicdevicesforinformationstorageandprocessing-caltechthesis | 2 | 0 % |
calculate structural fragility economic losses and human losses | 2 | 0 % |
imagehalftoningandinversereconstructionproblemswithconsiderationstoimagewatermarking-caltechthesis | 2 | 0 % |
foemat of experimental method in thesis | 2 | 0 % |
convexconeconditionsonthestructureofdesigns-caltechthesis | 2 | 0 % |
non-modalpartialmeltingofmetasedimentarypendantsinthesouthernsierranevadaandimplicationsforthedeeporiginofwithin-plutonisotopicheterogeneity-caltechthesis | 2 | 0 % |
microbe autism | 2 | 0 % |
plasticbucklingofcylindersunderbiaxialloading-caltechthesis | 2 | 0 % |
quantum theory of gravitational waves | 2 | 0 % |
http //thesis.library.caltech.edu/7647/ | 2 | 0 % |
continuous-fieldimage-correlationvelocimetryanditsapplicationtounsteadyflowoveranairfoil-caltechthesis | 2 | 0 % |
michael winterrose | 2 | 0 % |
celestial mechanics filetype pdf | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2005-01 -allrobots | 2 | 0 % |
hot wire heat transfer with different atmospheric pressure | 2 | 0 % |
aerosol dynamic equation | 2 | 0 % |
a nonlinear computer for the solution of servomechanism problems | 2 | 0 % |
h.a. gray | 2 | 0 % |
solvent extraction of orange oil | 2 | 0 % |
spectrographicstudyofgold-quartzoresfromalleghany california-caltechthesis | 2 | 0 % |
flowfieldaroundafiniteconewithshock-caltechthesis | 2 | 0 % |
http //thesis.library.caltech.edu/3334/ | 2 | 0 % |
fe2 - ti4 in tourmaline | 2 | 0 % |
frequencychirpandspectraldynamicsinsemiconductorlasers-caltechthesis | 2 | 0 % |
nh4 2so4 d2o | 2 | 0 % |
thegeologyofaportionofeasternventurabasin california-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2010-09 -main | 2 | 0 % |
knudsen diffusion | 2 | 0 % |
theparallelaccumulationanddistributionoftwopurine-oxidizingenzymesduringfrogdevelopment-caltechthesis | 2 | 0 % |
simulationsofcompressible diffusive reactiveflowswithdetailedchemistryusingahigh-orderhybridweno-cdscheme-caltechthesis | 2 | 0 % |
theintermetalliccompoundsinthesilver-strontiumsystemandtheircrystalstructures-caltechthesis | 2 | 0 % |
bucklingofcylindricalshellswithrandomimperfections-caltechthesis | 2 | 0 % |
diagram to make yb doped glass | 2 | 0 % |
optomechanics && thesis | 2 | 0 % |
time-temperatureresponseofmulti-phaseviscoelasticsolidsthroughnumericalanalysis-caltechthesis | 2 | 0 % |
i.theinclusionofmonohaptenicsubstancesinimmuneaggregates.ii.heteroligatingantibodyinanti-arsanilicacidsera-caltechthesis | 2 | 0 % |
supermesh-caltechthesis | 2 | 0 % |
basalmechanicsandgeologicrecordoficestreaming westantarctica-caltechthesis | 2 | 0 % |
themultiplicityofttauristarsinthestarformingregionstaurus-aurigaandophiucus-scorpius a2.2micrometerspeckleimagingsurvey-caltechthesis | 2 | 0 % |
oxidationofbutyricacidwithchromicanhydrideandsulfuricacid-caltechthesis | 2 | 0 % |
geologyofthesugarpinearea maderacounty california-caltechthesis | 2 | 0 % |
anexperimentalandnumericalinvestigationintoreactingvortexstructuresassociatedwithunstablecombustion-caltechthesis | 2 | 0 % |
an ab initio approach to the inverse problem-based design of photonic bandgap devices | 2 | 0 % |
camptothecin bt474 | 2 | 0 % |
oxygen isotope equilibrium with host lavas | 2 | 0 % |
thedistributionofbuoyantdensityofhumanerythrocytisinbovinealbuminsolutions-caltechthesis | 2 | 0 % |
ramon van handel phd caltech | 2 | 0 % |
lowtemperaturespecificheatstudiesofmolybdenum-rutheniumbasedsuperconductingmetallicglasses-caltechthesis | 2 | 0 % |
total synthesis of - -lemonomycin | 2 | 0 % |
hemoglobinization of red blood cells | 2 | 0 % |
asearchforheavystablechargedparticlesproducedinpairsinthedecayoftheneutralintermediatevectorbosonz-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2005-03 -unknownbrowser | 2 | 0 % |
lowenergyion-surfaceinteractionandepitaxialgrowthinthesigesystem-caltechthesis | 2 | 0 % |
six.nkg | 2 | 0 % |
thermalrearrangementsofsmallringhydrocarbons.photosensitizedrearrangementsofsmallringhydrocarbons-nonverticalenergytransfer-caltechthesis | 2 | 0 % |
king formula hot wire heat transfer | 2 | 0 % |
atmosphericphotooxidationoforganosulphurcompounds-caltechthesis | 2 | 0 % |
allostericinhibitionofzincfingerproteinsbydnabindingpolyamides-caltechthesis | 2 | 0 % |
volcanoes in la basin | 2 | 0 % |
itemswhereoptionis electricalengineering andyearis1998-caltechthesis | 2 | 0 % |
vitreloy | 2 | 0 % |
numericalsimulationofbaroclinicjovianvortices-caltechthesis | 2 | 0 % |
hypersonic boundary layer | 2 | 0 % |
pdf targeting proteins for degradation | 2 | 0 % |
investigationsintothegeneralityofmetalloinsertionatdnadefects-caltechthesis | 2 | 0 % |
adh4 lc/ms/ms | 2 | 0 % |
four-wavemixingandphaseconjugationinphotorefractivecrystals-caltechthesis | 2 | 0 % |
continuoussensorimotorcontrolmechanismsinposteriorparietalcortex forwardmodelencodingandtrajectorydecoding-caltechthesis | 2 | 0 % |
simply supported flat plate | 2 | 0 % |
itemswhereoptionis controlanddynamicalsystems andyearis2003-caltechthesis | 2 | 0 % |
http //thesis.library.caltech.edu/4229/ | 2 | 0 % |
hybrid processing | 2 | 0 % |
abstract thesis in asphalt | 2 | 0 % |
flexible polymer electronics applications thesis | 2 | 0 % |
explain how skewing increases zigzag leakage reactance? | 2 | 0 % |
thetranslationalmotionofparticlesinaviscoelasticliquid-caltechthesis | 2 | 0 % |
transcriptionalcontrolofspatiallyregulatedgenesintheearlyseaurchinembryo-caltechthesis | 2 | 0 % |
carboniumionrearrangementsinreactionsofcyclopropylcarbinylandcyclobutylderivatives-caltechthesis | 2 | 0 % |
thedimensionofspacetime-caltechthesis | 2 | 0 % |
fluid driven fracture | 2 | 0 % |
experimentalstudiesofconversioncoefficientsinsomedeformednuclei-caltechthesis | 2 | 0 % |
adding valuable information about structure-activity relationships of nhc-ruthenium catalysts | 2 | 0 % |
interferometricmeasurementofbrightnessdistributionsindiscreteradiosources-caltechthesis | 2 | 0 % |
phd thesis crism on mars pdf | 2 | 0 % |
studiesonthefeasibilityofisolatingtheacetylcholinereceptorbymeansofaffinitychromatography-caltechthesis | 2 | 0 % |
thermoelectric phd thesis | 2 | 0 % |
pdf vector and tensor analysis by lass h | 2 | 0 % |
saccaromyces cerevisiae | 2 | 0 % |
interactionsofvisualattentionandobjectrecognition computationalmodeling algorithms andpsychophysics-caltechthesis | 2 | 0 % |
alleghany ca | 2 | 0 % |
itemswhereoptionis controlanddynamicalsystems andyearis2006-caltechthesis | 2 | 0 % |
how to write acknowledgement for thesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2005-06 -unknownos | 2 | 0 % |
itemswhereoptionis aeronautics andyearis1977-caltechthesis | 2 | 0 % |
gary guthart thesis caltech | 2 | 0 % |
nominally 2-dimensional flow about a normal flat plate | 2 | 0 % |
geologyofthene1/4ofthehumphreysquadrangle losangelescounty california-caltechthesis | 2 | 0 % |
basepressureatsupersonicvelocities-caltechthesis | 2 | 0 % |
quenching of granitic melts | 2 | 0 % |
ananalogvlsimotionsensorbasedontheflyvisualsystem-caltechthesis | 2 | 0 % |
radioactiveelementsofalowatomicnumber-caltechthesis | 2 | 0 % |
zn precipitate in znsb | 2 | 0 % |
i interannualvariabilityofstratosphericozoneandtemperature.ii seasonalcycleofn2o-caltechthesis | 2 | 0 % |
itemswhereoptionis computationandneuralsystems andyearis2009-caltechthesis | 2 | 0 % |
rough surface in fluid | 2 | 0 % |
measurementofabsolutef-valuesofirongroupelements-caltechthesis | 2 | 0 % |
theoryofplasmawaveresonancesinahotnonuniformplasma-caltechthesis | 2 | 0 % |
panel flutter | 2 | 0 % |
diffusionbarriersforvlsiapplications-caltechthesis | 2 | 0 % |
particletransportinflowthroughporousmedia advection longitudinaldispersion andfiltration-caltechthesis | 2 | 0 % |
state space analysis of cuk converter | 2 | 0 % |
applicationofdiamondfilmstoelectricpropulsion lowenergysputteryieldmeasurementandmpdplasmaassistedchemicalvapordeposition-caltechthesis | 2 | 0 % |
peter brook caltech thesis | 2 | 0 % |
parti 3-phenylcyclobut-2-enoneand3-phenylcyclobutanonederivatives.partii calculationofthedelocalizationenergiesofsomesmall-ringsystemsemployingthesimplemolecularorbitaltreatment-caltechthesis | 2 | 0 % |
biogeochemicalmechanismsofarsenicmobilizationinhaiweereservoirsediments-caltechthesis | 2 | 0 % |
continuouslongtermobservationsofaccretingpulsars-caltechthesis | 2 | 0 % |
itemswhereoptionis appliedandcomputationalmathematics andyearis1993-caltechthesis | 2 | 0 % |
santa monica mountains geology | 2 | 0 % |
four-wavemixinginsemiconductoropticalamplifiersforterahertzspectroscopyandwavelengthconversion-caltechthesis | 2 | 0 % |
redox zonation at the lake tagel | 2 | 0 % |
ontheexistenceandstabilityofstandingsolitarywavesinfaradayresonance-caltechthesis | 2 | 0 % |
thesis submitted | 2 | 0 % |
caltech earthquake landers california | 2 | 0 % |
heavyhadronsinthelargenclimit-caltechthesis | 2 | 0 % |
thelifetimesoftheneutrallambdaparticlesandtheta-particles-caltechthesis | 2 | 0 % |
itemswhereoptionis civilengineering andyearis1975-caltechthesis | 2 | 0 % |
an thesis on non uniform | 2 | 0 % |
kinetics of methane oxidation under growndwater conditions | 2 | 0 % |
regulatorymechanismsoftheheatshockresponse-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2005-03 -unknownos | 2 | 0 % |
alleghany california | 2 | 0 % |
numericalstudyofpatternformingprocessesinmodelsofrotatingrayleigh-bnardconvection-caltechthesis | 2 | 0 % |
model support wind tunnel | 2 | 0 % |
basic principle of spatial beam shaping | 2 | 0 % |
low-costhigh-efficiencysolarcellswithwaferbondingandplasmonictechnologies-caltechthesis | 2 | 0 % |
periodicvariationsofthegravitationalforce.agravitysurveyinthemonkhillarea.transmissionofshotimpulsesinshallowwater.-caltechthesis | 2 | 0 % |
itemswhereoptionis geology andyearis1952-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2006-12 -lastrobots | 2 | 0 % |
passivemode-lockingandmillimeter-wavemodulationofquantumwelllasers-caltechthesis | 2 | 0 % |
http //thesis.library.caltech.edu/2597/2/wolfram_s_1980.pdf#page=11 | 2 | 0 % |
melany hunt caltech | 2 | 0 % |
atimecorrelatorforproblemsinaerodynamics-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2008-06 -main | 2 | 0 % |
anexperimentalstudyoffusionofvortexrings-caltechthesis | 2 | 0 % |
thesis of nanotubes | 2 | 0 % |
electrochemicalsensorsbasedondna-mediatedchargetransportchemistry-caltechthesis | 2 | 0 % |
pcr in thesis | 2 | 0 % |
jim harrington thesis | 2 | 0 % |
evolutionofgeneticcodes-caltechthesis | 2 | 0 % |
calculate false alarm rate | 2 | 0 % |
erin koos | 2 | 0 % |
mechanism of boiling | 2 | 0 % |
celia reina | 2 | 0 % |
microfluidiclargescaleintegrationanditsapplicationtosystemsbiology-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2010-01 -urlexit | 2 | 0 % |
schematic of hw-cvd | 2 | 0 % |
influenceofgeneticfactorsontheproductivityofrecombinantchinesehamsterovary cho cells-caltechthesis | 2 | 0 % |
acoustic entropy | 2 | 0 % |
anexperimentalinvestigationofpressuregradientsduetotemperaturegradientsinsmalldiametertubes-caltechthesis | 2 | 0 % |
how to make chloric acid | 2 | 0 % |
http //resolver.caltech.edu/caltechetd etd-11302007-075425 | 2 | 0 % |
designanddeploymentofbicep anovelsmall-aperturecmbpolarimetertotestinflationarycosmology-caltechthesis | 2 | 0 % |
aninvestigationoftheapplicationoftherayleigh-ritzmethodtothedeflectionofasmallaspectratiosweptplateofuniformthickness-caltechthesis | 2 | 0 % |
mechanism of film boiling | 2 | 0 % |
comparisonofthepropertiesofcholinergicdifferentiationfactorsandexaminationoftheirpossibleroleinvivo-caltechthesis | 2 | 0 % |
anexperimentalinvestigationofblockinginahigh-speed closedwindtunnelusingthewallpressuremethod-caltechthesis | 2 | 0 % |
the development of water-soluble olefin metathesis catalysts containing an n-heterocyclic carbene ligand jason p. | 2 | 0 % |
circlepatterns mesh edgeiteratorclassreference | 2 | 0 % |
bandit problem experiment lab | 2 | 0 % |
structuralstudiesofthee.colimethionineabctransporteranditscognatebindingprotein-caltechthesis | 2 | 0 % |
http //resolver.caltech.edu/caltechetd etd-09182007-093920 | 2 | 0 % |
theabsorptioncoefficientofhardgamma-rays-caltechthesis | 2 | 0 % |
thermodynamicandstructuralaspectsofequilibriumandmechanicallymilledyba2cu3o6 deltapowder-caltechthesis | 2 | 0 % |
effects of unbalanced wellness wheel | 2 | 0 % |
circlepatterns vertex edgearounditeratorclassreference | 2 | 0 % |
geologyoftheuppertickcanyonarea california-caltechthesis | 2 | 0 % |
gentamicin assay | 2 | 0 % |
hyper redundant robots | 2 | 0 % |
thesynthesisandstudyofredox-rich amido-bridgedcu2n2dicoppercomplexes-caltechthesis | 2 | 0 % |
robbett andrea | 2 | 0 % |
inquiriesintotheconsequencesofplanetary-scaleimpactsandtheimplicationsofcarbonatesinthehyper-aridcoreofthesahara-caltechthesis | 2 | 0 % |
on the structure of separatrix swept regions of slowly modulated hamiltonian systems. on the quantification of mixing in chaotic stokes flows the eccentric journal bearing | 2 | 0 % |
lrp5 c eleganss | 2 | 0 % |
diffusion theory pdf | 2 | 0 % |
thestressdistributioninreinforcedplatesunderconcentratededgeloads-caltechthesis | 2 | 0 % |
theoreticalstudyoftheelectronspinresonancespectraofcycloheptatrienyl-caltechthesis | 2 | 0 % |
adsorption.pdf | 2 | 0 % |
olefin metathesis z selective | 2 | 0 % |
theory of laminar viscous-inviscid interactions in supersonic flow | 2 | 0 % |
mutual information radar | 2 | 0 % |
function of rubber | 2 | 0 % |
south branch of santa monica fault map | 2 | 0 % |
balmer decrement | 2 | 0 % |
sand drains | 2 | 0 % |
wire array photovoltaics | 2 | 0 % |
increasedclassificationratesofchemicaldetectorsusingnovelsensortypesandoptimizedsensinggeometries-caltechthesis | 2 | 0 % |
stressconcentrationsinfillets-caltechthesis | 2 | 0 % |
studyofsolarmicrowaveradiationusingmultifrequencydata-caltechthesis | 2 | 0 % |
trackereffector-specificandmotorplanningsignalsinhumanfrontalandparietalcortices relevanceforgoal-directedactionandneuralprosthetics-caltechthesis | 2 | 0 % |
mechanics of consolidation | 2 | 0 % |
congruencesbetweencuspforms-caltechthesis | 2 | 0 % |
typedgravitationalfields-caltechthesis | 2 | 0 % |
itemswhereoptionis mechanicalengineering andyearis1990-caltechthesis | 2 | 0 % |
cal tech math dissertation 2013 | 2 | 0 % |
theneutron-protonmassdifference-caltechthesis | 2 | 0 % |
itemswhereoptionis biochemistry -caltechthesis | 2 | 0 % |
glomerulus cancer | 2 | 0 % |
nuclearmagneticresonancestudiesofsolventeffectonthemolecularstructureofsomearylandalkylethers-caltechthesis | 2 | 0 % |
studiesofchamberorganicaerosolusinganaerodynehigh-resolutiontime-of-flightaerosolmassspectrometer-caltechthesis | 2 | 0 % |
palladium thesis | 2 | 0 % |
astudyoftheeffectofviscosityontheresolutionofbandsinthepreparativeultracentrifuge-caltechthesis | 2 | 0 % |
dynamicroutingoftelephonetrafficusingnetworkmanagementtools-caltechthesis | 2 | 0 % |
liquidsloshinginanelasticcontainer-caltechthesis | 2 | 0 % |
o16 o18 | 2 | 0 % |
mos varactor vco design thesis | 2 | 0 % |
constant-pressurelaminarmixingofashearlayerwithaquiescentfluid-caltechthesis | 2 | 0 % |
excited state decay | 2 | 0 % |
fesibility studues | 2 | 0 % |
electron force field | 2 | 0 % |
homogeneous azeotropic distillation comparing entrainers | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2007-04 -main | 2 | 0 % |
thegeologyofmountwashington-caltechthesis | 2 | 0 % |
itemswhereoptionis chemicalengineering andyearis1972-caltechthesis | 2 | 0 % |
alex romero caltech | 2 | 0 % |
intermediatesincarboniumionreactionsofmethyl-substitutedcyclopropylcarbinyl cyclobutylandallylcarbinylderivatives-caltechthesis | 2 | 0 % |
particleshapeeffectsongas-solidreactions-caltechthesis | 2 | 0 % |
theconservationlawsofthreedimensionallinearizedelasticitytheory-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2012-02 -lasthosts | 2 | 0 % |
goverdhanram tripathi | 2 | 0 % |
binary nucleation | 2 | 0 % |
stm built | 2 | 0 % |
strengthofthinwalledcylinderssubjectedtocombinedcompressionandtorsion-caltechthesis | 2 | 0 % |
i.fluidflowinaprecessingsphericalcavity.ii.electromagneticradiationfromanexpandingsphereinamagneticfield-caltechthesis | 2 | 0 % |
wrinkling | 2 | 0 % |
afourierintegralapproachtoanaeolotropicmedium-caltechthesis | 2 | 0 % |
lapusta chen | 2 | 0 % |
predictionofstructuresandpropertiesfororganicsuperconductors-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2009-08 -errors404 | 2 | 0 % |
astudyofsomeproblemsaffectingthedesignofwingsfortransonicaircraft-caltechthesis | 2 | 0 % |
kellogg model iv fcc unit | 2 | 0 % |
thesis on elastic and thermoelastic properties of rubber like materials in pdf | 2 | 0 % |
http //thesis.library.caltech.edu/671/ | 2 | 0 % |
nonlineareffectsintravelingwavelaseramplifiers-caltechthesis | 2 | 0 % |
clean deletion of the nth gene from the chromosome of cc104 escherichia coli | 2 | 0 % |
notch delta | 2 | 0 % |
neotectonicsofthenorthfrontalfaultsystemofthesanbernardinomountains southerncalifornia cajonpasstolucernevalley-caltechthesis | 2 | 0 % |
studyofliquidmetalsbyelectrostaticlevitation-caltechthesis | 2 | 0 % |
terahertz sengupta | 2 | 0 % |
dort time reversal thesis | 2 | 0 % |
geologyofthevermiculitedeposits goldbutteminingdistrict southernvirginmountains nevada.ogivesoftheeasttwinglacier alaska--theirnatureandorigin.investigationsinthetakuglacierfirn alaska-caltechthesis | 2 | 0 % |
stretchingthedefinitionofalipidbilayer elasticitysroleinproteinandlipidorganization-caltechthesis | 2 | 0 % |
angularcorrelationsofsuccessivenuclearradiations-caltechthesis | 2 | 0 % |
measurement of thin film stress | 2 | 0 % |
rheo-optics investigation | 2 | 0 % |
minson bayesian | 2 | 0 % |
03012007 | 2 | 0 % |
generalizedtranslationoperators-caltechthesis | 2 | 0 % |
cal tech computer science dissertation | 2 | 0 % |
what is the mass of 1 m3 of hydrogen in 50 bar pressure | 2 | 0 % |
dedication page of thesis | 2 | 0 % |
microarrayandgenome-widesequencingapproachestocharacterizingdnabindingmolecules-caltechthesis | 2 | 0 % |
fracturetoughnessstudyonbulkmetallicglassesandnoveljoiningmethodusingbulkmetallicglasssolder-caltechthesis | 2 | 0 % |
konstantin batygin phd | 2 | 0 % |
itemswhereoptionis appliedmechanics andyearis1987-caltechthesis | 2 | 0 % |
lower puente | 2 | 0 % |
acknowlegement pdf | 2 | 0 % |
http //resolver.caltech.edu/caltechetd etd-06182009-081030 | 2 | 0 % |
darrell montague hiedi glesne | 2 | 0 % |
anexperimentalinvestigationoftheequilibriuminterfacetechnique-caltechthesis | 2 | 0 % |
bianchitypeicosmologicalmodels-caltechthesis | 2 | 0 % |
charles lee dailey | 2 | 0 % |
theoperationofcentrifugalpumpsunderabnormalconditions-caltechthesis | 2 | 0 % |
structural design of syphon well drop with model | 2 | 0 % |
measurement of changing pressure of ideal gas by pressure transmitter-thesis | 2 | 0 % |
interferenceeffectsbetweenmultiplebluffbodyflameholders-caltechthesis | 2 | 0 % |
aspectroscopicinvestigationoffouro-typesubdwarfs-caltechthesis | 2 | 0 % |
negativepionphotoproductionfromdeuteriumandapartialwaveanalysisofpositivepionandnegativepionphotoproductionintheenergyregion500to1250mev-caltechthesis | 2 | 0 % |
through-thickness compression | 2 | 0 % |
partialoxidationofhydrocarbonsusingtitaniumcontainingmolecularsieves-caltechthesis | 2 | 0 % |
conclusions on investigations of biotic specie | 2 | 0 % |
sharp bounds for compressive learning | 2 | 0 % |
base paper on artificial retina using thin film transistors driven by wireless power supply | 2 | 0 % |
morris noncolloidal | 2 | 0 % |
101102 | 2 | 0 % |
santa monica geology section | 2 | 0 % |
ontheinfluenceoftemperatureuponthephoto-electriceffect-caltechthesis | 2 | 0 % |
amino acid side chains of the postassium channel | 2 | 0 % |
centrifugal impeller vane solidity | 2 | 0 % |
protein detection microfluidic | 2 | 0 % |
apatite sulfate mars | 2 | 0 % |
the black hawk landslide | 2 | 0 % |
confirmational analysisg off proteins | 2 | 0 % |
protectingthepublicwelfareandmorals politicalinstitutions federalism andprohibition 1834-1934-caltechthesis | 2 | 0 % |
floating-pointsparsematrix-vectormultiplyforfpgas-caltechthesis | 2 | 0 % |
awavelengthdiversitytechniqueforsmoothingofspeckle-caltechthesis | 2 | 0 % |
concurrency for hierarchical structured items | 2 | 0 % |
caltech.edu climate sensitivity | 2 | 0 % |
k. w. trauger e. e. baird m. mrksich p. b. dervan j. am. chem. soc. 118 6160-6166 1996 | 2 | 0 % |
hydrogenase termites | 2 | 0 % |
erica deionno | 2 | 0 % |
itemswhereoptionis appliedphysics andyearis1989-caltechthesis | 2 | 0 % |
ondelayandsecurityinnetworkcoding-caltechthesis | 2 | 0 % |
map of pegmatite san diego | 2 | 0 % |
distributedaveragingandefficientfilesharingonpeer-to-peernetworks-caltechthesis | 2 | 0 % |
great bear lake uranium mine port radium | 2 | 0 % |
precisiondeterminationoftheenergyreleasedinnuclearreactionsinthelightelements-caltechthesis | 2 | 0 % |
statisticaloptimizationofmultiratesystemsandorthonormalfilterbanks-caltechthesis | 2 | 0 % |
thesis front page | 2 | 0 % |
fe-fe double bond | 2 | 0 % |
optimizednetworkdatastorageandtopologycontrol-caltechthesis | 2 | 0 % |
heisenberg turbulence theory | 2 | 0 % |
scaleeffectsincavitatingflow-caltechthesis | 2 | 0 % |
phd thesis protein design | 2 | 0 % |
threeessaysonmicroeconomictheory-caltechthesis | 2 | 0 % |
parti.interactionofdnaandhistoneinnucleohistone;partii.dormancyassociatedwithrepressionofgeneticactivity-caltechthesis | 2 | 0 % |
mixingandthegeometryofisosurfacesinturbulentjets-caltechthesis | 2 | 0 % |
satelite theory | 2 | 0 % |
oxidativednadamagebylongrangechargetransport-caltechthesis | 2 | 0 % |
dual arm manipulation | 2 | 0 % |
itemswhereoptionis aeronautics andyearis1984-caltechthesis | 2 | 0 % |
applications of coding in network communications | 2 | 0 % |
apreliminarystudyoftheproblemofboundarylayercontrol-caltechthesis | 2 | 0 % |
adsorption pdf | 2 | 0 % |
sarkis microbiome autism | 2 | 0 % |
itemswhereoptionis aeronautics andyearis1933-caltechthesis | 2 | 0 % |
caltech phd thesis | 2 | 0 % |
jinghao huang caltech thesis | 2 | 0 % |
multidimensionalmultiratefiltersandfilterbanks theory design andimplementation-caltechthesis | 2 | 0 % |
onsublatticesofpartitionlattices-caltechthesis | 2 | 0 % |
expression of couple due to wedge | 2 | 0 % |
subharmonic explanation | 2 | 0 % |
plasma filled waveguide thesis | 2 | 0 % |
photoelectrochemical reduction of chlorinated hydrocarbons | 2 | 0 % |
pullingelectronsoutofmetalsbyintenseelectricalfields-caltechthesis | 2 | 0 % |
itemswhereoptionis geologicalandplanetarysciences andyearis1952-caltechthesis | 2 | 0 % |
chemicalscaleinvestigationsofdrug-receptorinteractionsatthenicotinicacetylcholinereceptor-caltechthesis | 2 | 0 % |
linearprogrammingmethodsforthenumericalsolutionofparabolicequationsbackwardsintime-caltechthesis | 2 | 0 % |
thermodynamicfunctionsofpolyelectronicatomsatveryhightemperatures-caltechthesis | 2 | 0 % |
sams d. b. | 2 | 0 % |
geologyofthehumphreysstationarea losangelescounty california-caltechthesis | 2 | 0 % |
kaushik bhattacharya caltech 2013 | 2 | 0 % |
gntiii overexpression | 2 | 0 % |
periodic propeller forces in non-uniform flow | 2 | 0 % |
sample acknowledgement for thesis | 2 | 0 % |
theoptimaltransportationmethodinsolidmechanics-caltechthesis | 2 | 0 % |
thelatecenozoicgeologyofcajonpass implicationsfortectonicsandsedimentationalongthesanandreasfault-caltechthesis | 2 | 0 % |
hematite dissolution reductive co2 | 2 | 0 % |
domainwalldynamicsinion-implantedmagneticbubblematerials-caltechthesis | 2 | 0 % |
trautman robot navigation cooperation | 2 | 0 % |
hypervelocity impact plasma thesis | 2 | 0 % |
thesis on control switching technique of buck converter | 2 | 0 % |
i.developmentofacryogenicshocktube.ii.experimentalinvestigationoftheinteractionofashockwavewithliquidheliumiandii-caltechthesis | 2 | 0 % |
acknowledgement of project work to my husband | 2 | 0 % |
nano material simulation hmx | 2 | 0 % |
protein engineering stability with unnatural amino acids | 2 | 0 % |
theluminescentsolarconcentrator-caltechthesis | 2 | 0 % |
cosmologicalconsequencesofgravitation structureformationandgravitationalwaves-caltechthesis | 2 | 0 % |
princeton wong lilian | 2 | 0 % |
discharge flow depth relationships | 2 | 0 % |
diamondgrowthinlowpressureflames-caltechthesis | 2 | 0 % |
highlyavailabledistributedstoragesystems-caltechthesis | 2 | 0 % |
itemswhereyearis2001-caltechthesis | 2 | 0 % |
compressedsensing sparseapproximation andlow-rankmatrixestimation-caltechthesis | 2 | 0 % |
simulations modeling anddesignsofbulkmetallicglasses-caltechthesis | 2 | 0 % |
restorationofvisualacuityafteropticnervesectionandregeneration inastronotusocellatusagassiz-caltechthesis | 2 | 0 % |
some visibility problems in point lattices | 2 | 0 % |
mutagenic pollutant | 2 | 0 % |
aninvestigationofforcedflexuraltorsionaloscillationsofawingandthephenomenonofflutter-caltechthesis | 2 | 0 % |
ontheinteractionbetweenfirmlevelvariables thecapmbeta andstockreturns-caltechthesis | 2 | 0 % |
thesis on the unit circle | 2 | 0 % |
2d vortex flow | 2 | 0 % |
santa ana mountains geology | 2 | 0 % |
investigationofnoveleffectsinsemi-inclusivedeepinelasticscattering-caltechthesis | 2 | 0 % |
performancecalculationsofrockettripropellantsystems-caltechthesis | 2 | 0 % |
nanowicking multi-scaleflowinteractionwithnanofabricstructures-caltechthesis | 2 | 0 % |
au electrode dna | 2 | 0 % |
discretemechanicsandoptimalcontrolforspacetrajectorydesign-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2011-06 -main | 2 | 0 % |
designofpeptidesforsequence-specificrecognitionoftheminorgrooveofdna-caltechthesis | 2 | 0 % |
isonicotinaldehyde 1-oxide synthesis | 2 | 0 % |
control of uncertain systems | 2 | 0 % |
sidewash | 2 | 0 % |
computationalstrategyincatalystdesign-caltechthesis | 2 | 0 % |
filetype pdf raman powder spectrum amorphous sio2 | 2 | 0 % |
themultistrandsimulator stochasticsimulationofthekineticsofmultipleinteractingdnastrands-caltechthesis | 2 | 0 % |
a study of the entrainment and turbulence in a plane | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2010-04 -osdetail | 2 | 0 % |
low-energy high-resolution variableangle electronimpactspectroscopy-caltechthesis | 2 | 0 % |
aphotoelasticinvestigationoftheeffectofellipticalandmodifiedcutoutsinflatpanelssubjectedtocombinedbendingandshear-caltechthesis | 2 | 0 % |
does thermal ignite work | 2 | 0 % |
investigationofwavelengthconversionbyfour-wavemixinginsemiconductoropticalamplifiers-caltechthesis | 2 | 0 % |
http //thesis.library.caltech.edu/2245/2/02_acknowledgements.pdf | 2 | 0 % |
combustion instability in the rocket | 2 | 0 % |
irrigation | 2 | 0 % |
quadrangle mining job lake elsinore ca | 2 | 0 % |
theuniformlyvalidasymptoticapproximationstothesolutionsofcertainnon-linearordinarydifferentialequations-caltechthesis | 2 | 0 % |
the dissolution mechanisms of waterin silicate melts | 2 | 0 % |
two-dimensional irrotational mixed subsonic and supersonic flow | 2 | 0 % |
theroleofproteoglycansinthedeliveryofcationic-dnacomplexesandenhanceddeliverybyfolatereceptor-mediatedendocytosis-caltechthesis | 2 | 0 % |
fromgeometrytologic-caltechthesis | 2 | 0 % |
extremecopositivequadraticforms-caltechthesis | 2 | 0 % |
cal tech dissertation 2014 | 2 | 0 % |
introduction for thesis | 2 | 0 % |
thermodynamic properties of organometallic dihydrogen complexes for hydrogen storage applications | 2 | 0 % |
semiconductorstructuresinthequantumsizeregime-caltechthesis | 2 | 0 % |
itemswhereoptionis computerscience andyearis1996-caltechthesis | 2 | 0 % |
microtoroid quantum dot bumki min | 2 | 0 % |
theoptimaltransportationmeshfreemethodforgeneralfluidflowsandstronglycoupledfluid-structureinteractionproblems-caltechthesis | 2 | 0 % |
i.dynamicsofblockcopolymernanostructures.ii.polymerizabilityofcyclicolefinsandring-closingmetathesis-caltechthesis | 2 | 0 % |
numericalsimulationsofnon-sphericalbubblecollapse withapplicationstoshockwavelithotripsy-caltechthesis | 2 | 0 % |
reactivityandstructuralstudiesofmetalcomplexesboundtodna-caltechthesis | 2 | 0 % |
calculationoftheoptimumpitchdistributionofapropellerwithsweepback-caltechthesis | 2 | 0 % |
batio3 qingsong zhang | 2 | 0 % |
itemswhereoptionis biology andyearis1969-caltechthesis | 2 | 0 % |
photoconductivity of semiconductors | 2 | 0 % |
theburningofsingledropsoffuelinoxidizingatmospheres-caltechthesis | 2 | 0 % |
huntington disease phd thesis | 2 | 0 % |
geologyofpartsofthepacoimaandsylmarquadrangles-caltechthesis | 2 | 0 % |
thehelix-coiltransitionindna effectsoftheinteractionswithsmallionsandofthecompositionofdna-caltechthesis | 2 | 0 % |
meadow water table | 2 | 0 % |
studiesinfluiddynamicsasappliedtoseismologyandvolcanology-caltechthesis | 2 | 0 % |
onmagnetohydrodynamicflowoversolids-caltechthesis | 2 | 0 % |
femtosecondtime-resolvedspectroscopyofgas-phaseanions electronsolvationandchromophoredynamics-caltechthesis | 2 | 0 % |
definableequivalencerelationsonpolishspaces-caltechthesis | 2 | 0 % |
paper thermoacoustic instability in rijke tube | 2 | 0 % |
thecharacterizationandprocessingofthenonstructuralproteinsofsindbisvirus-caltechthesis | 2 | 0 % |
generalized de bruijn sequences | 2 | 0 % |
bending torsion flutter | 2 | 0 % |
acknowledgement for thesis | 2 | 0 % |
opticsatthenanoscale lightemissioninplasmonicnanocavities-caltechthesis | 2 | 0 % |
investigationsoncavitatinghydrofoils-caltechthesis | 2 | 0 % |
anelectronforcefieldforsimulatinglargescaleexcitedelectrondynamics-caltechthesis | 2 | 0 % |
targetingproteinsforubiquitinationanddegradationinthetreatmentofhumandisease-caltechthesis | 2 | 0 % |
performanceofcavitatingaxialinducerswithvaryingtipclearanceandsolidity-caltechthesis | 2 | 0 % |
itemswhereoptionis computationandneuralsystems andyearis2006-caltechthesis | 2 | 0 % |
reference side for bacteria | 2 | 0 % |
gatchel sands coalinga oil field | 2 | 0 % |
barium titanate oxygen vacancy pbe batio3 | 2 | 0 % |
crab nebula 12 inch telescope | 2 | 0 % |
julian romero economics | 2 | 0 % |
statistical analysis of turbulent boundary layer | 2 | 0 % |
heavyionrutherfordbackscatteringwithatimeofflightdetectorsystem-caltechthesis | 2 | 0 % |
vitreloy formation process | 2 | 0 % |
i.magneticresonancestudiesofparamagneticsolutions.ii.kineticsoftheferrousiron-oxygenreactioninacidicphosphate-pyrophosphatesolutions-caltechthesis | 2 | 0 % |
catalyticactivityanddeactivationmechanismsofsupportednioinch4oxidation-caltechthesis | 2 | 0 % |
crows sensor shayan | 2 | 0 % |
predictionofscanningtunnelingmicroscopeimagesbycomputationalquantumchemistry chemicalmodelsandsoftwaredesign-caltechthesis | 2 | 0 % |
glaciologicalstudiesinthest.eliasrange canada-caltechthesis | 2 | 0 % |
ultra-densenano-andmolecular-electroniccircuits-caltechthesis | 2 | 0 % |
estimationusingquantizedinnovationsforwirelesssensornetworks-caltechthesis | 2 | 0 % |
electrochemicalcharacterizationofsolidacidfuelcellelectrodes-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2011-07 -keywords | 2 | 0 % |
discretedifferentialformsubdivisionandvectorfieldgenerationovervolumetricdomain-caltechthesis | 2 | 0 % |
optical expressions of ion-pair interaction in minerals | 2 | 0 % |
itemswhereoptionis biochemistryandmolecularbiophysics andyearis1995-caltechthesis | 2 | 0 % |
acknowledgement examples for completion of phd | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2005-04 -urlentry | 2 | 0 % |
i.studiesinthechemistryofsodiumdithionite.ii.apreliminarystudyofthecatalyzedadditionofhydrogenchloridetovinylchlorideinastirredreactor-caltechthesis | 2 | 0 % |
mesoporous glass | 2 | 0 % |
geologyoftheplaceritacanyonarea-caltechthesis | 2 | 0 % |
numericalstudyofinterfacialflowwithsurfacetensionintwoandthreedimensions-caltechthesis | 2 | 0 % |
itemswhereoptionis appliedandcomputationalmathematics andyearis1994-caltechthesis | 2 | 0 % |
workhardeningduringpyramidalslipinzinc-caltechthesis | 2 | 0 % |
aninvestigationoftheresonanceconestructureinawarmanisotropicplasma-caltechthesis | 2 | 0 % |
continuousquantummeasurementofcoldalkali-atomspins-caltechthesis | 2 | 0 % |
explain the procedure for construction of resonant dc-to-dc converter | 2 | 0 % |
ontheconcentrationofspacechargeinthevicinityofaninsulatingsurface-caltechthesis | 2 | 0 % |
ontheviscoushypersonicblunt-bodyproblem-caltechthesis | 2 | 0 % |
towardsconcurrentarithmetic residuearithmeticandvlsi-caltechthesis | 2 | 0 % |
rollingmomentduetoyawofflatwingsoftrapezoidalplanformatsupersonicspeeds-caltechthesis | 2 | 0 % |
theformationkinetics mechanisms andthermodynamicsofs iv -aldehydeadditioncompounds-caltechthesis | 2 | 0 % |
stressesandstrainsincylindricalshells-caltechthesis | 2 | 0 % |
polyacetyleneandnovelconjugatedderivativesthroughthemetathesispolymerizationof1 3 5 7-cyclooctatetraenes-caltechthesis | 2 | 0 % |
itemswhereoptionis chemistry andyearis1921-caltechthesis | 2 | 0 % |
useofabsorbentsinnaturalgasanalysis-caltechthesis | 2 | 0 % |
bergthorson thesis | 2 | 0 % |
analysisofdefectstructuresinhighpuritycoppersinglecrystalsusingx-raytopographictechniques-caltechthesis | 2 | 0 % |
acknowledgements | 2 | 0 % |
glendora ca volcanic field | 2 | 0 % |
astudyofthemechanismofboilingheattransfer-caltechthesis | 2 | 0 % |
statisticsforthesis.library.caltech.edu 2010-06 -allhosts | 2 | 0 % |
measurement in boundary layer flow | 2 | 0 % |
cestrum nocturnum pdf | 2 | 0 % |
rolling buffer of three days of all unfiltered data filetype pdf | 2 | 0 % |
thepotentialofinertelectronsinsulfurousacidsolution-caltechthesis | 2 | 0 % |
itemswhereoptionis astronomy andyearis1982-caltechthesis | 2 | 0 % |
theschedulingprobleminlearningfromhints-caltechthesis | 2 | 0 % |
quantitativecharacterizationof3ddeformationsofcellinteractionswithsoftbiomaterials-caltechthesis | 2 | 0 % |
living polymerization kinetics romp | 2 | 0 % |
new directions in sparse sampling and estimation for underdetermined systems | 2 | 0 % |
sinteringofaerosolagglomerates-caltechthesis | 2 | 0 % |
geneticsandbiochemistryof redcells indrosophilamelanogaster-caltechthesis | 2 | 0 % |
Other phrases | 6162 | 66 % |